Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6537
Gene name
LocationContig_6:297747..299553
Strand-
Gene length (bp)1806
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05011 DBR1 Lariat debranching enzyme, C-terminal domain 1.4E-46 345 492
PF00149 Metallophos Calcineurin-like phosphoesterase 1.6E-04 30 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13765|DBR1_SCHPO Lariat debranching enzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbr1 PE=3 SV=2 4 491 3.0E-110
sp|Q6GPB8|DBR1A_XENLA Lariat debranching enzyme A OS=Xenopus laevis GN=dbr1-a PE=2 SV=1 4 238 1.0E-82
sp|Q7ZWU9|DBR1B_XENLA Lariat debranching enzyme B OS=Xenopus laevis GN=dbr1-b PE=2 SV=1 4 238 3.0E-82
sp|Q9UK59|DBR1_HUMAN Lariat debranching enzyme OS=Homo sapiens GN=DBR1 PE=1 SV=2 4 268 1.0E-81
sp|Q6P886|DBR1_XENTR Lariat debranching enzyme OS=Xenopus tropicalis GN=dbr1 PE=2 SV=1 4 238 4.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13765|DBR1_SCHPO Lariat debranching enzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbr1 PE=3 SV=2 4 491 3.0E-110
sp|Q6GPB8|DBR1A_XENLA Lariat debranching enzyme A OS=Xenopus laevis GN=dbr1-a PE=2 SV=1 4 238 1.0E-82
sp|Q7ZWU9|DBR1B_XENLA Lariat debranching enzyme B OS=Xenopus laevis GN=dbr1-b PE=2 SV=1 4 238 3.0E-82
sp|Q9UK59|DBR1_HUMAN Lariat debranching enzyme OS=Homo sapiens GN=DBR1 PE=1 SV=2 4 268 1.0E-81
sp|Q6P886|DBR1_XENTR Lariat debranching enzyme OS=Xenopus tropicalis GN=dbr1 PE=2 SV=1 4 238 4.0E-81
sp|Q923B1|DBR1_MOUSE Lariat debranching enzyme OS=Mus musculus GN=Dbr1 PE=1 SV=2 4 241 7.0E-81
sp|Q7T3E4|DBR1_DANRE Lariat debranching enzyme OS=Danio rerio GN=dbr1 PE=1 SV=1 4 242 4.0E-80
sp|Q6AU07|DBR1_ORYSJ Lariat debranching enzyme OS=Oryza sativa subsp. japonica GN=DBR1 PE=2 SV=1 4 281 2.0E-79
sp|Q9VSD7|DBR1_DROME Lariat debranching enzyme OS=Drosophila melanogaster GN=ldbr PE=1 SV=1 4 250 4.0E-78
sp|Q5ZLM2|DBR1_CHICK Lariat debranching enzyme OS=Gallus gallus GN=DBR1 PE=2 SV=1 4 242 5.0E-78
sp|Q94K01|DBR1_ARATH Lariat debranching enzyme OS=Arabidopsis thaliana GN=DBR1 PE=2 SV=1 4 267 2.0E-77
sp|Q29FE1|DBR1_DROPS Lariat debranching enzyme OS=Drosophila pseudoobscura pseudoobscura GN=DBR1 PE=3 SV=2 4 244 4.0E-76
sp|Q966M6|DBR1_CAEEL Lariat debranching enzyme OS=Caenorhabditis elegans GN=dbr-1 PE=3 SV=2 4 246 7.0E-72
sp|Q61D44|DBR1_CAEBR Lariat debranching enzyme OS=Caenorhabditis briggsae GN=dbr-1 PE=3 SV=1 5 246 9.0E-70
sp|P24309|DBR1_YEAST Lariat debranching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBR1 PE=1 SV=1 1 370 1.0E-67
sp|Q9VSD7|DBR1_DROME Lariat debranching enzyme OS=Drosophila melanogaster GN=ldbr PE=1 SV=1 348 492 2.0E-14
sp|Q5ZLM2|DBR1_CHICK Lariat debranching enzyme OS=Gallus gallus GN=DBR1 PE=2 SV=1 346 502 6.0E-13
sp|Q7T3E4|DBR1_DANRE Lariat debranching enzyme OS=Danio rerio GN=dbr1 PE=1 SV=1 346 494 1.0E-12
sp|Q29FE1|DBR1_DROPS Lariat debranching enzyme OS=Drosophila pseudoobscura pseudoobscura GN=DBR1 PE=3 SV=2 339 492 7.0E-12
sp|Q7ZWU9|DBR1B_XENLA Lariat debranching enzyme B OS=Xenopus laevis GN=dbr1-b PE=2 SV=1 344 493 1.0E-11
sp|Q6P886|DBR1_XENTR Lariat debranching enzyme OS=Xenopus tropicalis GN=dbr1 PE=2 SV=1 344 493 7.0E-11
sp|Q923B1|DBR1_MOUSE Lariat debranching enzyme OS=Mus musculus GN=Dbr1 PE=1 SV=2 346 502 3.0E-10
sp|Q61D44|DBR1_CAEBR Lariat debranching enzyme OS=Caenorhabditis briggsae GN=dbr-1 PE=3 SV=1 348 493 5.0E-10
sp|Q6GPB8|DBR1A_XENLA Lariat debranching enzyme A OS=Xenopus laevis GN=dbr1-a PE=2 SV=1 344 493 8.0E-10
sp|Q9UK59|DBR1_HUMAN Lariat debranching enzyme OS=Homo sapiens GN=DBR1 PE=1 SV=2 346 502 1.0E-09
sp|Q966M6|DBR1_CAEEL Lariat debranching enzyme OS=Caenorhabditis elegans GN=dbr-1 PE=3 SV=2 315 493 3.0E-09
sp|Q94K01|DBR1_ARATH Lariat debranching enzyme OS=Arabidopsis thaliana GN=DBR1 PE=2 SV=1 348 481 3.0E-07
sp|Q6AU07|DBR1_ORYSJ Lariat debranching enzyme OS=Oryza sativa subsp. japonica GN=DBR1 PE=2 SV=1 348 484 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0016787 hydrolase activity Yes
GO:0006397 mRNA processing Yes
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0090304 nucleic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016071 mRNA metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6537
MAGVRLAIEGCGHGTLDAIYASVAQSCKARGWPSVDALIIGGDFQAVRNTLDLNVMSVPQKYRQLGDFYAYYSGA
RRSPYLTIFIGGNHEASSHLVELYYGGWVAPNIYYLGAANVLRLGPIRIAALSGICKGNDYHKPHHERLPFSYRD
VKSAYHVRELDVRKLLQIRSQVDIGLSHDWPRGIEKHGDMNQLFKNKPFFKSESRDGTLGSAAAEMIMNRLRPPY
WFSAHLHTKFAAIKSYDDAGASGDAAESAAPAENLANPDEIDLDSNDGQGQSQGEEHATHDDAAKSQAGLDDEFQ
GETSGVETNHVAEELRAQLPASFARPTTAEASTTPGQPVPPEIVNKQVRFLALDKCLPKRQFLQLCEVVPFDSEE
LSRYPPGNGTSRYSLEYDPEWLSIVRTFHQDLVIGDPGARVPQDAGQEHYRPLIDAERAWVQENIVAKDKLRVPL
NFERTAPPHDAQSAQSVSVSEQPYEYTNPQTAAFCELVGLENLWDASQEEREARRRMPVHLTEPWGGGGGGGGRG
RGGGGRGGGRRGDGGRGRGRGGRGGRGRGG*
Coding >OphauB2|6537
ATGGCCGGTGTCCGCCTTGCAATTGAGGGCTGCGGCCACGGCACTCTAGACGCCATTTATGCATCCGTCGCGCAG
TCATGCAAGGCTCGTGGCTGGCCATCAGTCGACGCCCTCATTATTGGGGGCGACTTCCAGGCTGTGCGCAACACG
CTAGACTTGAATGTCATGTCGGTGCCGCAAAAGTATCGCCAGCTAGGCGACTTTTACGCCTACTATTCAGGCGCA
CGCCGTTCACCTTATCTAACCATTTTTATCGGAGGAAATCACGAGGCTAGTTCGCATCTTGTTGAGCTCTACTAT
GGCGGATGGGTGGCGCCAAACATCTACTATTTGGGCGCGGCCAATGTGTTGCGGCTGGGGCCCATTCGCATTGCT
GCTCTGTCGGGCATTTGCAAGGGCAATGACTACCACAAGCCGCATCATGAGCGGCTGCCCTTTTCATATCGCGAC
GTCAAGTCGGCTTACCATGTGCGCGAACTTGATGTGCGCAAGCTGCTTCAGATTCGCTCCCAAGTCGACATTGGC
TTGAGCCATGACTGGCCACGGGGCATCGAGAAGCATGGCGACATGAACCAGCTCTTCAAGAACAAGCCCTTTTTC
AAATCAGAGTCTCGGGATGGTACGCTGGGGAGCGCAGCCGCCGAGATGATAATGAACCGGCTACGGCCCCCTTAC
TGGTTTTCTGCGCACTTGCACACCAAGTTTGCAGCCATCAAAAGCTACGACGATGCTGGGGCTAGTGGTGATGCA
GCCGAATCTGCTGCCCCTGCCGAGAATCTGGCCAATCCAGACGAGATTGACCTAGACAGCAACGATGGTCAAGGC
CAAAGCCAGGGGGAGGAGCACGCAACGCATGACGATGCAGCAAAGTCCCAGGCAGGGCTTGATGATGAATTTCAA
GGCGAGACAAGTGGCGTCGAGACAAATCACGTAGCAGAGGAACTGCGTGCCCAGCTTCCTGCATCTTTTGCGCGG
CCAACAACAGCAGAGGCCAGCACAACACCAGGCCAGCCCGTACCGCCAGAGATTGTAAACAAGCAAGTGCGCTTC
TTGGCCTTGGACAAGTGTCTTCCCAAACGACAGTTTCTCCAACTCTGCGAAGTGGTGCCCTTTGACAGTGAAGAG
CTGTCCCGATACCCTCCCGGCAACGGCACAAGTCGCTACAGCCTGGAATACGACCCAGAATGGTTGTCAATTGTG
CGCACCTTTCACCAGGACCTCGTCATTGGCGACCCGGGAGCCCGCGTGCCCCAGGATGCGGGCCAAGAGCACTAC
CGGCCCCTCATTGACGCTGAGCGCGCTTGGGTGCAAGAAAACATTGTGGCCAAGGATAAGCTACGTGTGCCGCTA
AACTTTGAACGCACGGCGCCGCCACATGATGCTCAAAGTGCACAAAGTGTCTCGGTCTCGGAGCAGCCATACGAG
TATACGAATCCACAGACTGCCGCGTTTTGCGAGCTTGTTGGCCTTGAGAATCTGTGGGATGCTAGCCAAGAGGAG
CGAGAGGCGAGGAGGCGGATGCCGGTGCATCTGACGGAGCCGTGGGGAGGAGGAGGCGGCGGCGGTGGGAGAGGA
AGGGGAGGAGGAGGTAGAGGGGGAGGCAGAAGGGGAGACGGAGGCCGTGGACGAGGCCGAGGAGGAAGGGGAGGG
AGAGGGCGCGGAGGGTGA
Transcript >OphauB2|6537
ATGGCCGGTGTCCGCCTTGCAATTGAGGGCTGCGGCCACGGCACTCTAGACGCCATTTATGCATCCGTCGCGCAG
TCATGCAAGGCTCGTGGCTGGCCATCAGTCGACGCCCTCATTATTGGGGGCGACTTCCAGGCTGTGCGCAACACG
CTAGACTTGAATGTCATGTCGGTGCCGCAAAAGTATCGCCAGCTAGGCGACTTTTACGCCTACTATTCAGGCGCA
CGCCGTTCACCTTATCTAACCATTTTTATCGGAGGAAATCACGAGGCTAGTTCGCATCTTGTTGAGCTCTACTAT
GGCGGATGGGTGGCGCCAAACATCTACTATTTGGGCGCGGCCAATGTGTTGCGGCTGGGGCCCATTCGCATTGCT
GCTCTGTCGGGCATTTGCAAGGGCAATGACTACCACAAGCCGCATCATGAGCGGCTGCCCTTTTCATATCGCGAC
GTCAAGTCGGCTTACCATGTGCGCGAACTTGATGTGCGCAAGCTGCTTCAGATTCGCTCCCAAGTCGACATTGGC
TTGAGCCATGACTGGCCACGGGGCATCGAGAAGCATGGCGACATGAACCAGCTCTTCAAGAACAAGCCCTTTTTC
AAATCAGAGTCTCGGGATGGTACGCTGGGGAGCGCAGCCGCCGAGATGATAATGAACCGGCTACGGCCCCCTTAC
TGGTTTTCTGCGCACTTGCACACCAAGTTTGCAGCCATCAAAAGCTACGACGATGCTGGGGCTAGTGGTGATGCA
GCCGAATCTGCTGCCCCTGCCGAGAATCTGGCCAATCCAGACGAGATTGACCTAGACAGCAACGATGGTCAAGGC
CAAAGCCAGGGGGAGGAGCACGCAACGCATGACGATGCAGCAAAGTCCCAGGCAGGGCTTGATGATGAATTTCAA
GGCGAGACAAGTGGCGTCGAGACAAATCACGTAGCAGAGGAACTGCGTGCCCAGCTTCCTGCATCTTTTGCGCGG
CCAACAACAGCAGAGGCCAGCACAACACCAGGCCAGCCCGTACCGCCAGAGATTGTAAACAAGCAAGTGCGCTTC
TTGGCCTTGGACAAGTGTCTTCCCAAACGACAGTTTCTCCAACTCTGCGAAGTGGTGCCCTTTGACAGTGAAGAG
CTGTCCCGATACCCTCCCGGCAACGGCACAAGTCGCTACAGCCTGGAATACGACCCAGAATGGTTGTCAATTGTG
CGCACCTTTCACCAGGACCTCGTCATTGGCGACCCGGGAGCCCGCGTGCCCCAGGATGCGGGCCAAGAGCACTAC
CGGCCCCTCATTGACGCTGAGCGCGCTTGGGTGCAAGAAAACATTGTGGCCAAGGATAAGCTACGTGTGCCGCTA
AACTTTGAACGCACGGCGCCGCCACATGATGCTCAAAGTGCACAAAGTGTCTCGGTCTCGGAGCAGCCATACGAG
TATACGAATCCACAGACTGCCGCGTTTTGCGAGCTTGTTGGCCTTGAGAATCTGTGGGATGCTAGCCAAGAGGAG
CGAGAGGCGAGGAGGCGGATGCCGGTGCATCTGACGGAGCCGTGGGGAGGAGGAGGCGGCGGCGGTGGGAGAGGA
AGGGGAGGAGGAGGTAGAGGGGGAGGCAGAAGGGGAGACGGAGGCCGTGGACGAGGCCGAGGAGGAAGGGGAGGG
AGAGGGCGCGGAGGGTGA
Gene >OphauB2|6537
ATGGCCGGTGTCCGCCTTGCAATTGAGGGCTGCGTATGTAGCCCCCAGTTTCTGAGCCACTTGGTTTCGCCCAGG
CACCTTTACCACACAAACTAACATTTATATACATACAAGGGCCACGGCACTCTAGACGCCATTTATGCATCCGTC
GCGCAGTCATGCAAGGCTCGTGGCTGGCCATCAGTCGACGCCCTCATTATTGGGGGCGACTTCCAGGTGACGCCG
CCGCCCGCATGCATGCCTCTGGCCTCGAGCGGCGCTGATGAGTAGCAGGCTGTGCGCAACACGCTAGACTTGAAT
GTCATGTCGGTGCCGCAAAAGTATCGCCAGCTAGGCGACTTTTACGCCTACTATTCAGGCGCACGCCGTTCACCT
TATCTAACCATTTTTATCGGAGGAAATCACGAGGCTAGTTCGCATCTTGTTGAGCTCTACTATGGCGGATGGGTG
GCGCCAAACATCTACTATTTGGGCGCGGCCAATGTGTTGCGGCTGGGGCCCATTCGCATTGCTGCTCTGTCGGGC
ATTTGCAAGGGCAATGACTACCACAAGCCGCATCATGAGCGGCTGCCCTTTTCATATCGCGACGTCAAGTCGGCT
TACCATGTGCGCGAACTTGATGTGCGCAAGCTGCTTCAGATTCGCTCCCAAGTCGACATTGGCTTGAGCCATGAC
TGGCCACGGGGCATCGAGAAGCATGGCGACATGAACCAGCTCTTCAAGAACAAGCCCTTTTTCAAATCAGAGTCT
CGGGATGGTACGCTGGGGAGCGCAGCCGCCGAGATGATAATGAACCGGCTACGGCCCCCTTACTGGTTTTCTGCG
CACTTGCACACCAAGTTTGCAGCCATCAAAAGCTACGACGATGCTGGGGCTAGTGGTGATGCAGCCGAATCTGCT
GCCCCTGCCGAGAATCTGGCCAATCCAGACGAGATTGACCTAGACAGCAACGATGGTCAAGGCCAAAGCCAGGGG
GAGGAGCACGCAACGCATGACGATGCAGCAAAGTCCCAGGCAGGGCTTGATGATGAATTTCAAGGCGAGACAAGT
GGCGTCGAGACAAATCACGTAGCAGAGGAACTGCGTGCCCAGCTTCCTGCATCTTTTGCGCGGCCAACAACAGCA
GAGGCCAGCACAACACCAGGCCAGCCCGTACCGCCAGAGATTGTAAACAAGCAAGTGCGCTTCTTGGCCTTGGAC
AAGTGTCTTCCCAAACGACAGTTTCTCCAACTCTGCGAAGTGGTGCCCTTTGACAGTGAAGAGCTGTCCCGATAC
CCTCCCGGCAACGGCACAAGTCGCTACAGCCTGGAATACGACCCAGAATGGTTGTCAATTGTGCGCACCTTTCAC
CAGGACCTCGTCATTGGCGACCCGGGAGCCCGCGTGCCCCAGGATGCGGGCCAAGAGCACTACCGGCCCCTCATT
GACGCTGAGCGCGCTTGGGTGCAAGAAAACATTGTGGCCAAGGATAAGCTACGTGTGCCGCTAAACTTTGAACGC
ACGGCGCCGCCACATGATGCTCAAAGTGCACAAAGTGTCTCGGTCTCGGAGCAGCCATACGAGTATACGAATCCA
CAGACTGCCGCGTTTTGCGAGCTTGTTGGCCTTGAGAATCTGTGGGATGCTAGCCAAGAGGAGCGAGAGGCGAGG
AGGCGGATGCCGGTGCATCTGACGGAGCCGTGGGGAGGAGGAGGCGGCGGCGGTGGGAGAGGAAGGGGAGGAGGA
GGTAGAGGGGGAGGCAGAAGGGGAGACGGAGGCCGTGGACGAGGCCGAGGAGGAAGGGGAGGGAGAGGGCGCGGA
GGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail