Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6529
Gene name
LocationContig_6:273149..276183
Strand+
Gene length (bp)3034
Transcript length (bp)2655
Coding sequence length (bp)2655
Protein length (aa) 885

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11718 CPSF73-100_C Pre-mRNA 3'-end-processing endonuclease polyadenylation factor C-term 1.5E-79 533 881
PF10996 Beta-Casp Beta-Casp domain 1.6E-28 261 400
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 3.9E-19 33 205
PF16661 Lactamase_B_6 Metallo-beta-lactamase superfamily domain 1.2E-16 41 209
PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain 9.6E-06 431 494

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZS6|YSH1_NEUCR Endoribonuclease ysh-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ysh-1 PE=3 SV=1 1 884 0.0E+00
sp|Q59P50|YSH1_CANAL Endoribonuclease YSH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YSH1 PE=3 SV=1 21 750 0.0E+00
sp|Q4IPN9|YSH1_GIBZE Endoribonuclease YSH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YSH1 PE=3 SV=2 1 884 0.0E+00
sp|Q6BMW3|YSH1_DEBHA Endoribonuclease YSH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YSH1 PE=3 SV=2 10 519 0.0E+00
sp|Q4PEJ3|YSH1_USTMA Endoribonuclease YSH1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=YSH1 PE=3 SV=1 21 706 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZS6|YSH1_NEUCR Endoribonuclease ysh-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ysh-1 PE=3 SV=1 1 884 0.0E+00
sp|Q59P50|YSH1_CANAL Endoribonuclease YSH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YSH1 PE=3 SV=1 21 750 0.0E+00
sp|Q4IPN9|YSH1_GIBZE Endoribonuclease YSH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YSH1 PE=3 SV=2 1 884 0.0E+00
sp|Q6BMW3|YSH1_DEBHA Endoribonuclease YSH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YSH1 PE=3 SV=2 10 519 0.0E+00
sp|Q4PEJ3|YSH1_USTMA Endoribonuclease YSH1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=YSH1 PE=3 SV=1 21 706 0.0E+00
sp|Q74ZC0|YSH1_ASHGO Endoribonuclease YSH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YSH1 PE=3 SV=2 14 714 0.0E+00
sp|Q6CUI5|YSH1_KLULA Endoribonuclease YSH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YSH1 PE=3 SV=1 21 709 0.0E+00
sp|Q6FUA5|YSH1_CANGA Endoribonuclease YSH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YSH1 PE=3 SV=1 20 771 0.0E+00
sp|O13794|YSH1_SCHPO Endoribonuclease ysh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ysh1 PE=3 SV=2 14 750 0.0E+00
sp|Q6C2Z7|YSH1_YARLI Endoribonuclease YSH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YSH1 PE=3 SV=2 18 750 0.0E+00
sp|Q5BEP0|YSH1_EMENI Endoribonuclease ysh1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ysh1 PE=3 SV=1 14 884 0.0E+00
sp|Q4WRC2|YSH1_ASPFU Endoribonuclease ysh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ysh1 PE=3 SV=1 1 884 0.0E+00
sp|Q06224|YSH1_YEAST Endoribonuclease YSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSH1 PE=1 SV=1 25 750 0.0E+00
sp|Q9UKF6|CPSF3_HUMAN Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens GN=CPSF3 PE=1 SV=1 16 594 1.0E-173
sp|P79101|CPSF3_BOVIN Cleavage and polyadenylation specificity factor subunit 3 OS=Bos taurus GN=CPSF3 PE=1 SV=1 16 594 2.0E-173
sp|Q9QXK7|CPSF3_MOUSE Cleavage and polyadenylation specificity factor subunit 3 OS=Mus musculus GN=Cpsf3 PE=1 SV=2 16 594 8.0E-173
sp|Q86A79|CPSF3_DICDI Cleavage and polyadenylation specificity factor subunit 3 OS=Dictyostelium discoideum GN=cpsf3 PE=3 SV=1 28 704 3.0E-167
sp|Q9VE51|CPSF3_DROME Cleavage and polyadenylation specificity factor 73 OS=Drosophila melanogaster GN=Cpsf73 PE=1 SV=2 16 570 4.0E-166
sp|P0CM88|YSH1_CRYNJ Endoribonuclease YSH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YSH1 PE=3 SV=1 16 588 5.0E-165
sp|P0CM89|YSH1_CRYNB Endoribonuclease YSH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YSH1 PE=3 SV=1 16 588 5.0E-165
sp|Q9C952|CPSF3_ARATH Cleavage and polyadenylation specificity factor subunit 3-I OS=Arabidopsis thaliana GN=CPSF73-I PE=1 SV=1 7 696 5.0E-163
sp|Q3MHC2|INT11_RAT Integrator complex subunit 11 OS=Rattus norvegicus GN=Cpsf3l PE=2 SV=1 28 571 1.0E-74
sp|Q9CWS4|INT11_MOUSE Integrator complex subunit 11 OS=Mus musculus GN=Cpsf3l PE=1 SV=1 28 571 1.0E-74
sp|Q5TA45|INT11_HUMAN Integrator complex subunit 11 OS=Homo sapiens GN=CPSF3L PE=1 SV=2 28 570 3.0E-74
sp|Q5NVE6|INT11_PONAB Integrator complex subunit 11 OS=Pongo abelii GN=CPSF3L PE=2 SV=2 28 570 5.0E-74
sp|Q5ZIH0|INT11_CHICK Integrator complex subunit 11 OS=Gallus gallus GN=CPSF3L PE=2 SV=1 28 571 6.0E-74
sp|Q503E1|INT11_DANRE Integrator complex subunit 11 OS=Danio rerio GN=cpsf3l PE=2 SV=1 28 570 7.0E-73
sp|Q2YDM2|INT11_BOVIN Integrator complex subunit 11 OS=Bos taurus GN=CPSF3L PE=2 SV=2 28 570 2.0E-72
sp|Q8GUU3|CPS3B_ARATH Cleavage and polyadenylation specificity factor subunit 3-II OS=Arabidopsis thaliana GN=CPSF73-II PE=1 SV=2 26 502 2.0E-72
sp|Q54YL3|INT11_DICDI Integrator complex subunit 11 homolog OS=Dictyostelium discoideum GN=ints11 PE=3 SV=1 28 498 4.0E-70
sp|Q57626|Y162_METJA Uncharacterized protein MJ0162 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0162 PE=3 SV=1 29 496 2.0E-48
sp|Q58633|Y1236_METJA Uncharacterized protein MJ1236 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1236 PE=4 SV=1 28 504 8.0E-40
sp|Q60355|Y047_METJA Uncharacterized protein MJ0047 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0047 PE=3 SV=2 29 470 1.0E-31
sp|Q9LKF9|CPSF2_ARATH Cleavage and polyadenylation specificity factor subunit 2 OS=Arabidopsis thaliana GN=CPSF100 PE=1 SV=2 39 404 1.0E-31
sp|Q5SLP1|RNSE_THET8 Ribonuclease TTHA0252 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0252 PE=1 SV=1 28 470 2.0E-31
sp|Q652P4|CPSF2_ORYSJ Cleavage and polyadenylation specificity factor subunit 2 OS=Oryza sativa subsp. japonica GN=Os09g0569400 PE=2 SV=1 28 415 5.0E-31
sp|Q55BS1|CPSF2_DICDI Cleavage and polyadenylation specificity factor subunit 2 OS=Dictyostelium discoideum GN=cpsf2 PE=3 SV=1 20 403 9.0E-27
sp|Q9V3D6|CPSF2_DROME Probable cleavage and polyadenylation specificity factor subunit 2 OS=Drosophila melanogaster GN=Cpsf100 PE=1 SV=1 38 402 2.0E-25
sp|O17403|CPSF2_CAEEL Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis elegans GN=cpsf-2 PE=3 SV=1 28 402 2.0E-25
sp|A8XUS3|CPSF2_CAEBR Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis briggsae GN=cpsf-2 PE=3 SV=2 28 402 9.0E-25
sp|Q10568|CPSF2_BOVIN Cleavage and polyadenylation specificity factor subunit 2 OS=Bos taurus GN=CPSF2 PE=1 SV=1 28 406 7.0E-24
sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2 28 406 8.0E-24
sp|Q9W799|CPSF2_XENLA Cleavage and polyadenylation specificity factor subunit 2 OS=Xenopus laevis GN=cpsf2 PE=1 SV=1 28 406 1.0E-23
sp|O35218|CPSF2_MOUSE Cleavage and polyadenylation specificity factor subunit 2 OS=Mus musculus GN=Cpsf2 PE=1 SV=1 28 404 3.0E-23
sp|O74740|CFT2_SCHPO Cleavage factor two protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cft2 PE=1 SV=1 76 387 6.0E-18
sp|Q6BMW3|YSH1_DEBHA Endoribonuclease YSH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YSH1 PE=3 SV=2 534 750 2.0E-13
sp|Q55470|Y514_SYNY3 Uncharacterized protein sll0514 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0514 PE=4 SV=1 25 311 5.0E-11
sp|Q4R5Z4|INT9_MACFA Integrator complex subunit 9 OS=Macaca fascicularis GN=INTS9 PE=2 SV=1 27 388 3.0E-10
sp|Q8K114|INT9_MOUSE Integrator complex subunit 9 OS=Mus musculus GN=Ints9 PE=1 SV=1 27 388 6.0E-10
sp|P0CM88|YSH1_CRYNJ Endoribonuclease YSH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YSH1 PE=3 SV=1 654 767 3.0E-09
sp|P0CM89|YSH1_CRYNB Endoribonuclease YSH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YSH1 PE=3 SV=1 654 767 3.0E-09
sp|Q2KJA6|INT9_BOVIN Integrator complex subunit 9 OS=Bos taurus GN=INTS9 PE=2 SV=1 27 388 6.0E-09
sp|Q9NV88|INT9_HUMAN Integrator complex subunit 9 OS=Homo sapiens GN=INTS9 PE=1 SV=2 27 388 1.0E-08
sp|Q5ZKK2|INT9_CHICK Integrator complex subunit 9 OS=Gallus gallus GN=INTS9 PE=2 SV=1 27 388 2.0E-08
sp|Q6DFF4|INT9_XENLA Integrator complex subunit 9 OS=Xenopus laevis GN=ints9 PE=2 SV=1 63 388 6.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup983
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3527
Ophiocordyceps australis map64 (Brazil) OphauB2|6529 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06617
Ophiocordyceps camponoti-rufipedis Ophun1|7425
Ophiocordyceps kimflemingae Ophio5|7568
Ophiocordyceps subramaniannii Hirsu2|7966

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6529
MAAKRKASAMKAGDEPMDPADELMFLCLGGGNEVGRSCHIVQYKGKTVMLDAGQHPAYDGLAALPFYDDFDLSTV
DVLLISHFHVDHAASLPYVLSKTNFKGRVFMTHPTKAIYKWLIQDSVRVGNTAANASVQPVYTEQDHLNTFPQIE
AIDYHTTHTISSIRITPYPAGHVLGAAMFLIEIAGLKVFFTGDYSREQDRHLVSAEVPKGIKIDVLITESTYGIA
SHVPRVEREQALLKTITNILNRGGRALLPVFALGRAQELLLILDEYWSKHPEYQRFPIYYASNLARKCMIVYQTY
VGAMNDNIKRLFRERMAEAEAAAAAGDSKATSAGPWDFKYIRSLKNLDRFDDVGGCVMLASPGMLQSGISRELFE
RWAPSDKNGVIITGYSVEGTMARQLMQEPDQIQAVMSRSMTGARRAPGGDSDRVLIPRRCSVAEYSFAAHVDGVE
NREFIEEVAAPVVILVHGEQHNMMRLKSKLLSLNASKTTKVKVFSPRNCEELRIPFKSDKTAKVVGKLASIPPPK
ALDAAPALVTGVLVQNDFKLSLMAADDLREYAGLNTTTITCKQRLRLAAAGPELVKWALEGTFGVVDDVAPAQGK
KEDGDDSEADGNGEAAQQHDGHGDSEDKPEAKQATLELATLAAREADGASSLVAAYLVMGCVTVRYYANRNVDLE
WQGNMLNDSIADSVMAVLFSLESTPAAVKHTAHSHSHSHQDSHDDSHQPSPNPHANCSPAQRLERLFWFLEAQFG
ADNVSPVETPKLPLDDGDDDDNEAKNHVVAKTEKTDDDADDAAADGEGGGDGEEEQNGDAPDEPASDLETRRTRE
IQRLHKLGIPVPGVRIQVDKMSATVWLETLEVESNNKIFADRVRAIMERAVEVTAPLWA*
Coding >OphauB2|6529
ATGGCGGCCAAGCGCAAGGCGTCGGCCATGAAGGCAGGTGACGAGCCCATGGACCCCGCCGACGAGCTCATGTTC
CTGTGCCTGGGCGGCGGCAACGAGGTGGGCCGATCTTGCCACATTGTGCAATACAAGGGCAAAACAGTCATGCTC
GACGCCGGCCAGCACCCAGCCTACGATGGCCTCGCTGCACTGCCCTTTTACGACGACTTTGACCTCAGCACCGTC
GACGTGCTCCTCATCAGCCACTTCCACGTCGACCACGCTGCCTCGCTCCCCTACGTGCTCTCCAAGACAAACTTC
AAGGGCCGCGTCTTCATGACACACCCGACAAAGGCCATTTACAAGTGGCTCATCCAGGATAGCGTCCGCGTCGGC
AACACGGCCGCCAATGCCTCGGTCCAGCCCGTCTACACGGAGCAGGACCATCTCAACACCTTTCCCCAGATTGAG
GCCATTGACTACCACACAACCCACACCATTTCCTCCATCCGCATCACCCCCTATCCCGCCGGCCACGTCTTGGGC
GCCGCCATGTTTCTCATTGAGATTGCCGGCCTCAAGGTCTTTTTTACCGGCGACTACTCGCGCGAGCAGGACCGC
CACCTCGTCTCGGCCGAAGTGCCCAAGGGCATCAAGATTGACGTGCTCATTACCGAGTCCACCTATGGCATTGCC
TCGCACGTGCCGCGTGTTGAGCGCGAGCAGGCCCTCCTCAAGACCATTACCAACATTCTCAACCGCGGCGGCCGC
GCCCTGCTGCCCGTCTTTGCCCTCGGCCGCGCCCAGGAGCTCCTCCTCATCCTCGACGAGTACTGGTCCAAGCAC
CCCGAGTACCAGCGCTTCCCCATATACTATGCCAGCAATCTGGCACGCAAGTGCATGATTGTCTACCAGACCTAT
GTCGGCGCCATGAACGACAACATTAAGCGCCTCTTCCGCGAACGCATGGCCGAGGCCGAGGCGGCTGCCGCTGCC
GGCGACTCCAAGGCCACGTCTGCCGGGCCCTGGGACTTCAAGTACATTCGCTCTCTCAAGAATCTCGACCGCTTC
GACGATGTTGGCGGCTGCGTCATGCTTGCCAGCCCTGGAATGCTGCAGAGCGGCATCAGCCGCGAGCTTTTTGAG
CGCTGGGCGCCCAGCGACAAGAACGGCGTCATCATCACCGGCTACAGCGTCGAGGGCACCATGGCCCGACAGCTG
ATGCAGGAGCCAGACCAGATACAGGCCGTCATGTCGCGCAGCATGACGGGCGCTCGCAGGGCTCCTGGCGGCGAC
TCGGACAGGGTCTTGATTCCCCGGCGCTGCAGCGTCGCCGAATACTCTTTTGCCGCCCATGTGGATGGAGTTGAA
AATCGCGAATTCATCGAAGAAGTCGCTGCGCCAGTCGTGATTCTTGTCCACGGCGAGCAGCACAACATGATGCGC
CTCAAGTCCAAGCTCCTCTCCCTCAACGCCTCCAAGACGACCAAGGTCAAGGTGTTTTCCCCGCGCAACTGCGAA
GAGCTGCGCATCCCCTTCAAGTCGGACAAGACGGCCAAGGTGGTGGGCAAGCTGGCGTCGATTCCGCCGCCCAAG
GCGCTCGACGCAGCGCCCGCCCTCGTCACGGGCGTCTTGGTGCAAAACGACTTCAAGCTGTCCCTCATGGCAGCA
GACGACTTGCGCGAATATGCCGGACTCAACACGACGACGATTACGTGCAAGCAGCGCCTGCGCCTGGCGGCTGCG
GGGCCCGAATTAGTCAAGTGGGCGCTCGAGGGCACCTTTGGCGTCGTTGACGATGTGGCGCCGGCACAGGGCAAA
AAGGAGGACGGCGACGATTCAGAGGCAGATGGGAATGGTGAAGCGGCGCAGCAGCATGACGGGCATGGCGACAGT
GAGGACAAGCCCGAGGCAAAGCAAGCGACGCTAGAGCTTGCAACGCTTGCAGCTCGCGAGGCAGACGGCGCCTCG
TCCCTCGTGGCCGCCTACCTCGTCATGGGCTGCGTCACGGTCCGCTACTACGCCAACCGCAACGTCGACCTTGAA
TGGCAGGGCAACATGCTCAACGACAGCATCGCCGACTCTGTCATGGCCGTCCTCTTCTCCCTCGAAAGCACCCCC
GCCGCCGTCAAGCACACCGCCCACTCCCACTCCCACTCCCACCAAGACTCTCACGACGACTCTCACCAGCCCTCG
CCCAACCCGCACGCAAACTGCTCGCCCGCCCAGCGCCTCGAGCGCCTCTTTTGGTTCCTCGAAGCCCAGTTTGGC
GCCGACAATGTCTCCCCCGTCGAGACGCCCAAACTGCCCCTCGACGATGGAGATGACGACGACAATGAAGCAAAA
AATCACGTCGTCGCCAAGACGGAAAAGACTGACGACGACGCCGACGACGCCGCCGCCGACGGCGAGGGTGGCGGC
GACGGCGAGGAGGAACAAAATGGCGATGCGCCCGACGAGCCTGCTTCAGACTTGGAGACTCGGCGCACAAGAGAA
ATCCAACGACTACATAAACTCGGCATTCCCGTACCCGGCGTGCGCATCCAAGTCGACAAAATGTCTGCCACTGTA
TGGCTCGAAACACTCGAGGTTGAGTCCAACAATAAAATCTTTGCCGATCGGGTAAGGGCAATCATGGAGAGGGCC
GTCGAGGTCACAGCGCCGTTATGGGCATGA
Transcript >OphauB2|6529
ATGGCGGCCAAGCGCAAGGCGTCGGCCATGAAGGCAGGTGACGAGCCCATGGACCCCGCCGACGAGCTCATGTTC
CTGTGCCTGGGCGGCGGCAACGAGGTGGGCCGATCTTGCCACATTGTGCAATACAAGGGCAAAACAGTCATGCTC
GACGCCGGCCAGCACCCAGCCTACGATGGCCTCGCTGCACTGCCCTTTTACGACGACTTTGACCTCAGCACCGTC
GACGTGCTCCTCATCAGCCACTTCCACGTCGACCACGCTGCCTCGCTCCCCTACGTGCTCTCCAAGACAAACTTC
AAGGGCCGCGTCTTCATGACACACCCGACAAAGGCCATTTACAAGTGGCTCATCCAGGATAGCGTCCGCGTCGGC
AACACGGCCGCCAATGCCTCGGTCCAGCCCGTCTACACGGAGCAGGACCATCTCAACACCTTTCCCCAGATTGAG
GCCATTGACTACCACACAACCCACACCATTTCCTCCATCCGCATCACCCCCTATCCCGCCGGCCACGTCTTGGGC
GCCGCCATGTTTCTCATTGAGATTGCCGGCCTCAAGGTCTTTTTTACCGGCGACTACTCGCGCGAGCAGGACCGC
CACCTCGTCTCGGCCGAAGTGCCCAAGGGCATCAAGATTGACGTGCTCATTACCGAGTCCACCTATGGCATTGCC
TCGCACGTGCCGCGTGTTGAGCGCGAGCAGGCCCTCCTCAAGACCATTACCAACATTCTCAACCGCGGCGGCCGC
GCCCTGCTGCCCGTCTTTGCCCTCGGCCGCGCCCAGGAGCTCCTCCTCATCCTCGACGAGTACTGGTCCAAGCAC
CCCGAGTACCAGCGCTTCCCCATATACTATGCCAGCAATCTGGCACGCAAGTGCATGATTGTCTACCAGACCTAT
GTCGGCGCCATGAACGACAACATTAAGCGCCTCTTCCGCGAACGCATGGCCGAGGCCGAGGCGGCTGCCGCTGCC
GGCGACTCCAAGGCCACGTCTGCCGGGCCCTGGGACTTCAAGTACATTCGCTCTCTCAAGAATCTCGACCGCTTC
GACGATGTTGGCGGCTGCGTCATGCTTGCCAGCCCTGGAATGCTGCAGAGCGGCATCAGCCGCGAGCTTTTTGAG
CGCTGGGCGCCCAGCGACAAGAACGGCGTCATCATCACCGGCTACAGCGTCGAGGGCACCATGGCCCGACAGCTG
ATGCAGGAGCCAGACCAGATACAGGCCGTCATGTCGCGCAGCATGACGGGCGCTCGCAGGGCTCCTGGCGGCGAC
TCGGACAGGGTCTTGATTCCCCGGCGCTGCAGCGTCGCCGAATACTCTTTTGCCGCCCATGTGGATGGAGTTGAA
AATCGCGAATTCATCGAAGAAGTCGCTGCGCCAGTCGTGATTCTTGTCCACGGCGAGCAGCACAACATGATGCGC
CTCAAGTCCAAGCTCCTCTCCCTCAACGCCTCCAAGACGACCAAGGTCAAGGTGTTTTCCCCGCGCAACTGCGAA
GAGCTGCGCATCCCCTTCAAGTCGGACAAGACGGCCAAGGTGGTGGGCAAGCTGGCGTCGATTCCGCCGCCCAAG
GCGCTCGACGCAGCGCCCGCCCTCGTCACGGGCGTCTTGGTGCAAAACGACTTCAAGCTGTCCCTCATGGCAGCA
GACGACTTGCGCGAATATGCCGGACTCAACACGACGACGATTACGTGCAAGCAGCGCCTGCGCCTGGCGGCTGCG
GGGCCCGAATTAGTCAAGTGGGCGCTCGAGGGCACCTTTGGCGTCGTTGACGATGTGGCGCCGGCACAGGGCAAA
AAGGAGGACGGCGACGATTCAGAGGCAGATGGGAATGGTGAAGCGGCGCAGCAGCATGACGGGCATGGCGACAGT
GAGGACAAGCCCGAGGCAAAGCAAGCGACGCTAGAGCTTGCAACGCTTGCAGCTCGCGAGGCAGACGGCGCCTCG
TCCCTCGTGGCCGCCTACCTCGTCATGGGCTGCGTCACGGTCCGCTACTACGCCAACCGCAACGTCGACCTTGAA
TGGCAGGGCAACATGCTCAACGACAGCATCGCCGACTCTGTCATGGCCGTCCTCTTCTCCCTCGAAAGCACCCCC
GCCGCCGTCAAGCACACCGCCCACTCCCACTCCCACTCCCACCAAGACTCTCACGACGACTCTCACCAGCCCTCG
CCCAACCCGCACGCAAACTGCTCGCCCGCCCAGCGCCTCGAGCGCCTCTTTTGGTTCCTCGAAGCCCAGTTTGGC
GCCGACAATGTCTCCCCCGTCGAGACGCCCAAACTGCCCCTCGACGATGGAGATGACGACGACAATGAAGCAAAA
AATCACGTCGTCGCCAAGACGGAAAAGACTGACGACGACGCCGACGACGCCGCCGCCGACGGCGAGGGTGGCGGC
GACGGCGAGGAGGAACAAAATGGCGATGCGCCCGACGAGCCTGCTTCAGACTTGGAGACTCGGCGCACAAGAGAA
ATCCAACGACTACATAAACTCGGCATTCCCGTACCCGGCGTGCGCATCCAAGTCGACAAAATGTCTGCCACTGTA
TGGCTCGAAACACTCGAGGTTGAGTCCAACAATAAAATCTTTGCCGATCGGGTAAGGGCAATCATGGAGAGGGCC
GTCGAGGTCACAGCGCCGTTATGGGCATGA
Gene >OphauB2|6529
ATGGCGGCCAAGCGCAAGGCGTCGGCCATGAAGGCAGGTGACGAGCCCATGGACCCCGCCGACGAGCTCATGTTC
CTGTGCCTGGGCGGCGGCAACGAGGTGGGCCGATCTTGCCACATTGTGCAATACAAGGGCAAAACAGTCATGGTG
CGTTTTGAACAGCTCTCCAGCCATCATCAGACGGCTAACAAGAGCCGCTGCTCCAGCTCGACGCCGGCCAGCACC
CAGCCTACGATGGCCTCGCTGCACTGCCCTTTTACGACGACTTTGACCTCAGCACCGTCGACGTGCTCCTCATCA
GCCAGTAAGTGACGACTTGATGCCCCCTCGTGTATACTGGGCCAGATGGAAACAAGGCGGCATCGTGGTGTAGTC
TCGTGTGGCTCTGTGTATGGCAGATGAATACATTTTTTCCATGGACTGCTTCTGCTTCAGTCGGCATTGTCGGTG
ACGGCATCTTTGACTGTGTTCGGGACGCGCTTGCTCGCAGCCACCAAGCAACGTGTCGACTGACCCTGTCTGAAA
CAGCTTCCACGTCGACCACGCTGCCTCGCTCCCCTACGTGCTCTCCAAGACAAACTTCAAGGGCCGCGTCTTCAT
GACACACCCGACAAAGGCCATTTACAAGTGGCTCATCCAGGATAGCGTCCGCGTCGGCAACACGGCCGCCAATGC
CTCGGTCCAGCCCGTCTACACGGAGCAGGACCATCTCAACACCTTTCCCCAGATTGAGGCCATTGACTACCACAC
AACCCACACCATTTCCTCCATCCGCATCACCCCCTATCCCGCCGGCCACGTCTTGGGCGCCGCCATGTTTCTCAT
TGAGATTGCCGGCCTCAAGGTCTTTTTTACCGGCGACTACTCGCGCGAGCAGGACCGCCACCTCGTCTCGGCCGA
AGTGCCCAAGGGCATCAAGATTGACGTGCTCATTACCGAGTCCACCTATGGCATTGCCTCGCACGTGCCGCGTGT
TGAGCGCGAGCAGGCCCTCCTCAAGACCATTACCAACATTCTCAACCGCGGCGGCCGCGCCCTGCTGCCCGTCTT
TGCCCTCGGCCGCGCCCAGGAGCTCCTCCTCATCCTCGACGAGTACTGGTCCAAGCACCCCGAGTACCAGCGCTT
CCCCATATACTATGCCAGCAATCTGGCACGCAAGTGCATGATTGTCTACCAGACCTATGTCGGCGCCATGAACGA
CAACATTAAGCGCCTCTTCCGCGAACGCATGGCCGAGGCCGAGGCGGCTGCCGCTGCCGGCGACTCCAAGGCCAC
GTCTGCCGGGCCCTGGGACTTCAAGTACATTCGCTCTCTCAAGAATCTCGACCGCTTCGACGATGTTGGCGGCTG
CGTCATGCTTGCCAGCCCTGGAATGCTGCAGAGCGGCATCAGCCGCGAGCTTTTTGAGCGCTGGGCGCCCAGCGA
CAAGAACGGCGTCATCATCACCGGCTACAGCGTCGAGGGCACCATGGCCCGACAGCTGATGCAGGAGCCAGACCA
GATACAGGCCGTCATGTCGCGCAGCATGACGGGCGCTCGCAGGGCTCCTGGCGGCGACTCGGACAGGGTCTTGAT
TCCCCGGCGCTGCAGCGTCGCCGAATACTCTTTTGCCGCCCATGTGGATGGAGTTGAAAATCGCGAATTCATCGA
AGAAGTCGCTGCGCCAGTCGTGGTGAGTCTTGCCGCCCCAATGACTCTTCTCTCTCGCCTTTCTGCGACTTGACC
TGATTGCCACTTTTACCGGCGACTTGCTGACCCTGTCGCGCAGATTCTTGTCCACGGCGAGCAGCACAACATGAT
GCGCCTCAAGTCCAAGCTCCTCTCCCTCAACGCCTCCAAGACGACCAAGGTCAAGGTGTTTTCCCCGCGCAACTG
CGAAGAGCTGCGCATCCCCTTCAAGTCGGACAAGACGGCCAAGGTGGTGGGCAAGCTGGCGTCGATTCCGCCGCC
CAAGGCGCTCGACGCAGCGCCCGCCCTCGTCACGGGCGTCTTGGTGCAAAACGACTTCAAGCTGTCCCTCATGGC
AGCAGACGACTTGCGCGAATATGCCGGACTCAACACGACGACGATTACGTGCAAGCAGCGCCTGCGCCTGGCGGC
TGCGGGGCCCGAATTAGTCAAGTGGGCGCTCGAGGGCACCTTTGGCGTCGTTGACGATGTGGCGCCGGCACAGGG
CAAAAAGGAGGACGGCGACGATTCAGAGGCAGATGGGAATGGTGAAGCGGCGCAGCAGCATGACGGGCATGGCGA
CAGTGAGGACAAGCCCGAGGCAAAGCAAGCGACGCTAGAGCTTGCAACGCTTGCAGCTCGCGAGGCAGACGGCGC
CTCGTCCCTCGTGGCCGCCTACCTCGTCATGGGCTGCGTCACGGTCCGCTACTACGCCAACCGCAACGTCGACCT
TGAATGGCAGGGCAACATGCTCAACGACAGCATCGCCGACTCTGTCATGGCCGTCCTCTTCTCCCTCGAAAGCAC
CCCCGCCGCCGTCAAGCACACCGCCCACTCCCACTCCCACTCCCACCAAGACTCTCACGACGACTCTCACCAGCC
CTCGCCCAACCCGCACGCAAACTGCTCGCCCGCCCAGCGCCTCGAGCGCCTCTTTTGGTTCCTCGAAGCCCAGTT
TGGCGCCGACAATGTCTCCCCCGTCGAGACGCCCAAACTGCCCCTCGACGATGGAGATGACGACGACAATGAAGC
AAAAAATCACGTCGTCGCCAAGACGGAAAAGACTGACGACGACGCCGACGACGCCGCCGCCGACGGCGAGGGTGG
CGGCGACGGCGAGGAGGAACAAAATGGCGATGCGCCCGACGAGCCTGCTTCAGACTTGGAGACTCGGCGCACAAG
AGAAATCCAACGACTACATAAACTCGGCATTCCCGTACCCGGCGTGCGCATCCAAGTCGACAAAATGTCTGCCAC
TGTATGGCTCGAAACACTCGAGGTTGAGTCCAACAATAAAATCTTTGCCGATCGGGTAAGGGCAATCATGGAGAG
GGCCGTCGAGGTCACAGCGCCGTTATGGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail