Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6526
Gene name
LocationContig_6:267051..268254
Strand-
Gene length (bp)1203
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain 2.5E-43 190 345
PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain 2.6E-42 31 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11803|OTC_EMENI Ornithine carbamoyltransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=argB PE=2 SV=1 1 355 7.0E-166
sp|P0C2P3|OTC_ASPTN Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=arg1 PE=3 SV=1 26 355 1.0E-164
sp|P0C2P2|OTC_ASPTE Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus terreus GN=arg1 PE=3 SV=1 26 355 1.0E-164
sp|P0CL21|OTC_COCIM Ornithine carbamoyltransferase, mitochondrial OS=Coccidioides immitis (strain RS) GN=CIMG_04084 PE=1 SV=1 30 355 2.0E-163
sp|P11066|OTC_ASPNG Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus niger GN=argB PE=2 SV=1 4 355 3.0E-161
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11803|OTC_EMENI Ornithine carbamoyltransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=argB PE=2 SV=1 1 355 7.0E-166
sp|P0C2P3|OTC_ASPTN Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=arg1 PE=3 SV=1 26 355 1.0E-164
sp|P0C2P2|OTC_ASPTE Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus terreus GN=arg1 PE=3 SV=1 26 355 1.0E-164
sp|P0CL21|OTC_COCIM Ornithine carbamoyltransferase, mitochondrial OS=Coccidioides immitis (strain RS) GN=CIMG_04084 PE=1 SV=1 30 355 2.0E-163
sp|P11066|OTC_ASPNG Ornithine carbamoyltransferase, mitochondrial OS=Aspergillus niger GN=argB PE=2 SV=1 4 355 3.0E-161
sp|P31317|OTC_SCHPO Ornithine carbamoyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg3 PE=1 SV=1 30 355 5.0E-115
sp|P14995|OTC_PACTA Ornithine carbamoyltransferase, mitochondrial OS=Pachysolen tannophilus GN=OTC PE=3 SV=1 24 355 2.0E-113
sp|P05150|OTC_YEAST Ornithine carbamoyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG3 PE=1 SV=1 31 354 3.0E-96
sp|Q9YHY9|OTC_CHICK Ornithine carbamoyltransferase, mitochondrial OS=Gallus gallus GN=OTC PE=1 SV=1 31 345 9.0E-90
sp|P78605|OTC_TRAHI Ornithine carbamoyltransferase, mitochondrial OS=Trametes hirsuta PE=3 SV=1 32 346 5.0E-89
sp|P11725|OTC_MOUSE Ornithine carbamoyltransferase, mitochondrial OS=Mus musculus GN=Otc PE=1 SV=1 29 345 2.0E-87
sp|P00480|OTC_HUMAN Ornithine carbamoyltransferase, mitochondrial OS=Homo sapiens GN=OTC PE=1 SV=3 29 345 4.0E-87
sp|P00481|OTC_RAT Ornithine carbamoyltransferase, mitochondrial OS=Rattus norvegicus GN=Otc PE=1 SV=1 5 345 6.0E-87
sp|P84010|OTC_SHEEP Ornithine carbamoyltransferase, mitochondrial OS=Ovis aries GN=OTC PE=1 SV=1 29 345 9.0E-87
sp|O19072|OTC_PIG Ornithine carbamoyltransferase, mitochondrial (Fragment) OS=Sus scrofa GN=OTC PE=2 SV=1 29 345 4.0E-86
sp|Q9N1U7|OTC_BOVIN Ornithine carbamoyltransferase, mitochondrial OS=Bos taurus GN=OTC PE=2 SV=1 31 345 7.0E-86
sp|P31326|OTC_LITCT Ornithine carbamoyltransferase, mitochondrial OS=Lithobates catesbeiana PE=2 SV=1 26 345 2.0E-85
sp|A4XLM2|OTC_CALS8 Ornithine carbamoyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=argF PE=3 SV=1 31 345 2.0E-78
sp|P18186|OTC_BACSU Ornithine carbamoyltransferase OS=Bacillus subtilis (strain 168) GN=argF PE=1 SV=1 31 354 3.0E-74
sp|Q18E28|OTC_HALWD Ornithine carbamoyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=arcB PE=3 SV=1 29 345 4.0E-73
sp|Q3A9W4|OTC_CARHZ Ornithine carbamoyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=argF PE=3 SV=1 26 345 6.0E-72
sp|A0RR73|OTC_CAMFF Ornithine carbamoyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=argF PE=3 SV=1 31 345 2.0E-70
sp|O93656|OTC_PYRAB Ornithine carbamoyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=argF PE=3 SV=4 29 345 4.0E-69
sp|O58457|OTC_PYRHO Ornithine carbamoyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=argF PE=3 SV=3 29 345 5.0E-69
sp|Q51742|OTC_PYRFU Ornithine carbamoyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=argF PE=1 SV=6 31 345 2.0E-68
sp|Q9K8V8|OTC_BACHD Ornithine carbamoyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argF PE=3 SV=1 29 350 5.0E-68
sp|Q5JI16|OTC_THEKO Ornithine carbamoyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=argF PE=3 SV=1 31 345 1.0E-67
sp|B7GM02|OTC_ANOFW Ornithine carbamoyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=argF PE=3 SV=1 29 345 6.0E-67
sp|Q731G7|OTC_BACC1 Ornithine carbamoyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=argF PE=3 SV=1 31 345 1.0E-66
sp|B9IXC5|OTC_BACCQ Ornithine carbamoyltransferase OS=Bacillus cereus (strain Q1) GN=arcB PE=3 SV=1 31 345 2.0E-66
sp|B7HNP5|OTC_BACC7 Ornithine carbamoyltransferase OS=Bacillus cereus (strain AH187) GN=arcB PE=3 SV=1 31 345 2.0E-66
sp|Q635F4|OTC_BACCZ Ornithine carbamoyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=argF PE=3 SV=1 31 345 3.0E-66
sp|Q818W3|OTC_BACCR Ornithine carbamoyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=argF PE=3 SV=1 31 345 4.0E-66
sp|O29013|OTC_ARCFU Ornithine carbamoyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argF PE=3 SV=1 31 345 9.0E-66
sp|Q8TKT5|OTC_METAC Ornithine carbamoyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argF PE=3 SV=1 31 345 1.0E-65
sp|Q81M99|OTC_BACAN Ornithine carbamoyltransferase OS=Bacillus anthracis GN=argF PE=1 SV=1 31 345 3.0E-65
sp|C3LJQ5|OTC_BACAC Ornithine carbamoyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=arcB PE=3 SV=1 31 345 3.0E-65
sp|C3P7R4|OTC_BACAA Ornithine carbamoyltransferase OS=Bacillus anthracis (strain A0248) GN=arcB PE=3 SV=1 31 345 3.0E-65
sp|Q6HE32|OTC_BACHK Ornithine carbamoyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argF PE=3 SV=1 31 345 4.0E-65
sp|Q3J8G0|OTC_NITOC Ornithine carbamoyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=argF PE=3 SV=1 32 350 1.0E-64
sp|C1ER02|OTC_BACC3 Ornithine carbamoyltransferase OS=Bacillus cereus (strain 03BB102) GN=arcB PE=3 SV=1 31 345 2.0E-64
sp|A7ZCL8|OTC_CAMC1 Ornithine carbamoyltransferase OS=Campylobacter concisus (strain 13826) GN=arcB PE=3 SV=1 31 345 4.0E-64
sp|Q465R0|OTC_METBF Ornithine carbamoyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=argF PE=3 SV=1 31 345 1.0E-63
sp|A3CU82|OTC_METMJ Ornithine carbamoyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=argF PE=3 SV=1 31 345 2.0E-63
sp|A7GZL8|OTC_CAMC5 Ornithine carbamoyltransferase OS=Campylobacter curvus (strain 525.92) GN=arcB PE=3 SV=1 31 345 1.0E-62
sp|Q9YAE7|OTC_AERPE Ornithine carbamoyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=argF PE=3 SV=2 29 349 2.0E-62
sp|A1WUZ6|OTC_HALHL Ornithine carbamoyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=argF PE=3 SV=1 31 346 3.0E-62
sp|Q8Q0J1|OTC_METMA Ornithine carbamoyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argF PE=3 SV=2 31 345 3.0E-62
sp|Q71Z80|OTC_LISMF Ornithine carbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argF PE=3 SV=1 31 345 1.0E-61
sp|Q4FT48|OTC_PSYA2 Ornithine carbamoyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=argF PE=3 SV=1 31 352 2.0E-61
sp|B8DHF4|OTC_LISMH Ornithine carbamoyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=arcB PE=3 SV=1 31 345 2.0E-61
sp|A5WDJ2|OTC_PSYWF Ornithine carbamoyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=argF PE=3 SV=1 31 355 4.0E-61
sp|Q9CEY4|PTC_LACLA Putrescine carbamoyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ptcA PE=3 SV=1 31 345 4.0E-61
sp|Q2FPP7|OTC_METHJ Ornithine carbamoyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=argF PE=3 SV=1 31 345 4.0E-61
sp|Q92BC1|OTC_LISIN Ornithine carbamoyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argF PE=3 SV=1 31 345 8.0E-61
sp|Q7M8B5|OTC_WOLSU Ornithine carbamoyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argF PE=3 SV=1 31 345 9.0E-61
sp|Q1QAR3|OTC_PSYCK Ornithine carbamoyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=argF PE=3 SV=1 31 355 1.0E-60
sp|Q67JZ8|OTC_SYMTH Ornithine carbamoyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=argF PE=3 SV=1 29 345 1.0E-60
sp|Q2SRJ4|PTC_MYCCT Putrescine carbamoyltransferase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=ptcA PE=3 SV=1 29 345 2.0E-60
sp|Q8Y6U5|OTC_LISMO Ornithine carbamoyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argF PE=3 SV=1 31 345 2.0E-60
sp|Q7VHJ0|OTC_HELHP Ornithine carbamoyltransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=argF PE=3 SV=1 31 345 3.0E-60
sp|A2SQ85|OTC_METLZ Ornithine carbamoyltransferase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=argF PE=3 SV=1 31 345 3.0E-60
sp|P96134|OTC_THET2 Ornithine carbamoyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argF PE=1 SV=1 30 345 3.0E-60
sp|Q31I95|OTC_THICR Ornithine carbamoyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=argF PE=3 SV=1 31 346 3.0E-60
sp|Q6NHG6|OTC_CORDI Ornithine carbamoyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=argF PE=3 SV=1 29 345 4.0E-60
sp|Q0C4M2|OTC_HYPNA Ornithine carbamoyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=argF PE=3 SV=1 31 345 1.0E-59
sp|A1U324|OTC_MARHV Ornithine carbamoyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=argF PE=3 SV=1 31 352 1.0E-59
sp|Q8YFA2|OTC_BRUME Ornithine carbamoyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=argF PE=3 SV=2 31 353 2.0E-59
sp|Q57F56|OTC_BRUAB Ornithine carbamoyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=argF PE=3 SV=1 31 353 2.0E-59
sp|Q2YPH2|OTC_BRUA2 Ornithine carbamoyltransferase OS=Brucella abortus (strain 2308) GN=arcB PE=3 SV=1 31 353 2.0E-59
sp|B0V6G5|OTC_ACIBY Ornithine carbamoyltransferase OS=Acinetobacter baumannii (strain AYE) GN=arcB PE=3 SV=1 31 346 2.0E-59
sp|A1AWA3|OTC_RUTMC Ornithine carbamoyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=argF PE=3 SV=1 31 345 2.0E-59
sp|Q8G2L7|OTC_BRUSU Ornithine carbamoyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=argF PE=3 SV=1 31 353 2.0E-59
sp|Q30TL4|OTC_SULDN Ornithine carbamoyltransferase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=argF PE=3 SV=1 31 340 2.0E-59
sp|A3M663|OTC_ACIBT Ornithine carbamoyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=argF PE=3 SV=2 31 346 3.0E-59
sp|Q2G3J8|OTC_NOVAD Ornithine carbamoyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=argF PE=3 SV=1 31 345 4.0E-59
sp|A5VNP2|OTC_BRUO2 Ornithine carbamoyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=argF PE=3 SV=1 31 353 6.0E-59
sp|Q74GU2|OTC_GEOSL Ornithine carbamoyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=argF PE=3 SV=1 31 345 6.0E-59
sp|Q8DW19|PTC_STRMU Putrescine carbamoyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ptcA PE=1 SV=1 34 345 6.0E-59
sp|Q58291|OTC_METJA Ornithine carbamoyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argF PE=3 SV=1 71 346 1.0E-58
sp|Q7NWJ6|OTC_CHRVO Ornithine carbamoyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=argF PE=3 SV=1 31 346 1.0E-58
sp|Q6FCH8|OTC_ACIAD Ornithine carbamoyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=argF PE=3 SV=1 31 346 2.0E-58
sp|P11724|OTC_PSEAE Ornithine carbamoyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argF PE=1 SV=3 31 351 2.0E-58
sp|Q88NX4|OTC_PSEPK Ornithine carbamoyltransferase OS=Pseudomonas putida (strain KT2440) GN=argF PE=3 SV=3 31 349 3.0E-58
sp|Q6AR58|OTC_DESPS Ornithine carbamoyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=argF PE=3 SV=1 30 349 4.0E-58
sp|Q3SVB0|OTC_NITWN Ornithine carbamoyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=argF PE=3 SV=1 30 345 4.0E-58
sp|Q1QVM7|OTC_CHRSD Ornithine carbamoyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=argF PE=3 SV=1 31 352 5.0E-58
sp|B7S4N1|PTC_STRRT Putrescine carbamoyltransferase OS=Streptococcus ratti GN=ptcA PE=3 SV=2 34 345 6.0E-58
sp|Q97C32|OTCC_THEVO Ornithine carbamoyltransferase, catabolic OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=arcB PE=3 SV=1 31 345 7.0E-58
sp|A6Q1W6|OTC_NITSB Ornithine carbamoyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=argF PE=3 SV=1 31 345 2.0E-57
sp|Q6MSR6|PTC_MYCMS Putrescine carbamoyltransferase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=ptcA PE=3 SV=1 29 345 4.0E-57
sp|Q8ET05|OTC_OCEIH Ornithine carbamoyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argF PE=3 SV=1 19 345 4.0E-57
sp|Q971Y3|OTC_SULTO Ornithine carbamoyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=argF PE=3 SV=1 31 345 7.0E-57
sp|A1VZY2|OTC_CAMJJ Ornithine carbamoyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=argF PE=3 SV=1 31 354 9.0E-57
sp|Q5HUG8|OTC_CAMJR Ornithine carbamoyltransferase OS=Campylobacter jejuni (strain RM1221) GN=argF PE=3 SV=1 31 354 1.0E-56
sp|O67607|OTC_AQUAE Ornithine carbamoyltransferase OS=Aquifex aeolicus (strain VF5) GN=argF PE=3 SV=1 31 346 1.0E-56
sp|Q39Z73|OTC_GEOMG Ornithine carbamoyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=argF PE=3 SV=1 31 345 1.0E-56
sp|A6VJK4|OTC_METM7 Ornithine carbamoyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=argF PE=3 SV=1 33 351 1.0E-56
sp|A3DL27|OTC_STAMF Ornithine carbamoyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=arcB PE=3 SV=1 24 345 1.0E-56
sp|Q8TWG4|OTC_METKA Ornithine carbamoyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=argF PE=3 SV=1 32 345 2.0E-56
sp|Q606D8|OTC_METCA Ornithine carbamoyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=argF PE=3 SV=1 29 346 2.0E-56
sp|Q8UI70|OTC_AGRFC Ornithine carbamoyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=argF PE=3 SV=1 30 345 2.0E-56
sp|A8FM43|OTC_CAMJ8 Ornithine carbamoyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=arcB PE=3 SV=1 31 354 2.0E-56
sp|Q1MLV9|OTC_RHIL3 Ornithine carbamoyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=argF PE=3 SV=1 30 345 2.0E-56
sp|A6UTW9|OTC_META3 Ornithine carbamoyltransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=argF PE=3 SV=1 32 346 2.0E-56
sp|Q59283|OTC_CORGL Ornithine carbamoyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=argF PE=3 SV=2 31 354 2.0E-56
sp|Q07GY2|OTC_RHOP5 Ornithine carbamoyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=argF PE=3 SV=1 30 345 3.0E-56
sp|Q9PNU6|OTC_CAMJE Ornithine carbamoyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=argF PE=1 SV=1 31 354 3.0E-56
sp|Q6LZS1|OTC_METMP Ornithine carbamoyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=argF PE=3 SV=1 33 351 5.0E-56
sp|Q98BB6|OTC_RHILO Ornithine carbamoyltransferase OS=Rhizobium loti (strain MAFF303099) GN=argF PE=3 SV=1 34 345 5.0E-56
sp|Q6N0J0|OTC_RHOPA Ornithine carbamoyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=argF PE=3 SV=1 30 345 6.0E-56
sp|Q97ZM1|OTC_SULSO Ornithine carbamoyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=argF PE=3 SV=1 28 349 1.0E-55
sp|A7H345|OTC_CAMJD Ornithine carbamoyltransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=arcB PE=3 SV=1 31 354 2.0E-55
sp|A6QC22|OTC_SULNB Ornithine carbamoyltransferase OS=Sulfurovum sp. (strain NBC37-1) GN=argF PE=3 SV=1 31 345 2.0E-55
sp|A8ACB1|OTC_IGNH4 Ornithine carbamoyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=arcB PE=3 SV=1 31 345 2.0E-55
sp|Q92S99|OTC_RHIME Ornithine carbamoyltransferase OS=Rhizobium meliloti (strain 1021) GN=argF PE=3 SV=1 31 345 3.0E-55
sp|A5UMK3|OTC_METS3 Ornithine carbamoyltransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=argF PE=3 SV=1 71 349 4.0E-55
sp|A1ATU5|OTC_PELPD Ornithine carbamoyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=argF PE=3 SV=1 31 345 4.0E-55
sp|Q39DI7|OTC_BURL3 Ornithine carbamoyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=argF PE=3 SV=1 31 346 4.0E-55
sp|A7I3W8|OTC_CAMHC Ornithine carbamoyltransferase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=argF PE=3 SV=1 31 353 5.0E-55
sp|A8F7Z9|OTC_PSELT Ornithine carbamoyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=argF PE=3 SV=1 31 337 6.0E-55
sp|Q89VE8|OTC_BRADU Ornithine carbamoyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argF PE=3 SV=1 30 345 6.0E-55
sp|A4T9W6|OTC_MYCGI Ornithine carbamoyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=argF PE=3 SV=1 31 345 6.0E-55
sp|A2BM26|OTC_HYPBU Ornithine carbamoyltransferase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=argF PE=3 SV=1 31 345 1.0E-54
sp|A0RUE9|OTC_CENSY Ornithine carbamoyltransferase OS=Cenarchaeum symbiosum (strain A) GN=argF PE=3 SV=1 29 345 1.0E-54
sp|B4E9G6|OTC_BURCJ Ornithine carbamoyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=arcB PE=3 SV=1 31 346 2.0E-54
sp|A0K9X6|OTC_BURCH Ornithine carbamoyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=argF PE=3 SV=1 31 346 2.0E-54
sp|Q1BU60|OTC_BURCA Ornithine carbamoyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=argF PE=3 SV=1 31 346 2.0E-54
sp|Q8FTN1|OTC_COREF Ornithine carbamoyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=argF PE=3 SV=1 31 345 2.0E-54
sp|A5IN78|OTC_THEP1 Ornithine carbamoyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=argF PE=3 SV=1 29 345 3.0E-54
sp|A4FYS5|OTC_METM5 Ornithine carbamoyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=argF PE=3 SV=1 33 351 3.0E-54
sp|Q82UP4|OTC_NITEU Ornithine carbamoyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argF PE=3 SV=1 31 355 3.0E-54
sp|Q63WM2|OTC_BURPS Ornithine carbamoyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=argF PE=3 SV=1 31 346 4.0E-54
sp|Q62M76|OTC_BURMA Ornithine carbamoyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=argF PE=3 SV=1 31 346 4.0E-54
sp|Q02047|OTC1_PSESH Ornithine carbamoyltransferase 1, phaseolotoxin-sensitive OS=Pseudomonas savastanoi pv. phaseolicola GN=argF PE=1 SV=3 31 349 5.0E-54
sp|Q1QQG6|OTC_NITHX Ornithine carbamoyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=argF PE=3 SV=1 30 345 5.0E-54
sp|Q43814|OTC_PEA Ornithine carbamoyltransferase, chloroplastic OS=Pisum sativum GN=ARGF PE=2 SV=1 31 345 7.0E-54
sp|O50039|OTC_ARATH Ornithine carbamoyltransferase, chloroplastic OS=Arabidopsis thaliana GN=OTC PE=1 SV=2 31 345 1.0E-53
sp|A0LUC1|OTC_ACIC1 Ornithine carbamoyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=argF PE=3 SV=1 31 345 2.0E-53
sp|Q8XWC0|OTC_RALSO Ornithine carbamoyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=argF PE=3 SV=1 31 346 3.0E-53
sp|Q837U7|PTC_ENTFA Putrescine carbamoyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ptcA PE=1 SV=1 31 345 3.0E-53
sp|A5V656|OTC_SPHWW Ornithine carbamoyltransferase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=argF PE=3 SV=1 31 345 7.0E-53
sp|Q2LT98|OTC_SYNAS Ornithine carbamoyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=argF PE=3 SV=1 31 349 7.0E-53
sp|P96108|OTC_THEMA Ornithine carbamoyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=argF PE=1 SV=2 29 345 7.0E-53
sp|Q6L135|OTC_PICTO Ornithine carbamoyltransferase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=argF PE=3 SV=1 74 345 8.0E-53
sp|A1VEP9|OTC_DESVV Ornithine carbamoyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=argF PE=3 SV=1 30 346 9.0E-53
sp|Q72D35|OTC_DESVH Ornithine carbamoyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=argF PE=3 SV=1 30 346 9.0E-53
sp|Q9HIK9|OTCC_THEAC Ornithine carbamoyltransferase, catabolic OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=arcB PE=3 SV=2 31 345 9.0E-53
sp|Q87XL4|OTC_PSESM Ornithine carbamoyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argF PE=3 SV=3 31 349 1.0E-52
sp|Q4J8Z2|OTC_SULAC Ornithine carbamoyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=argF PE=3 SV=1 29 349 1.0E-52
sp|Q30YB7|OTC_DESAG Ornithine carbamoyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=argF PE=3 SV=1 31 346 1.0E-52
sp|B2UBA4|OTC_RALPJ Ornithine carbamoyltransferase OS=Ralstonia pickettii (strain 12J) GN=arcB PE=3 SV=1 31 346 2.0E-52
sp|A0QYS8|OTC_MYCS2 Ornithine carbamoyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=argF PE=1 SV=1 31 345 2.0E-52
sp|Q9ZB62|OTC_GEOSE Ornithine carbamoyltransferase OS=Geobacillus stearothermophilus GN=argF PE=3 SV=1 69 345 3.0E-52
sp|Q0AEE3|OTC_NITEC Ornithine carbamoyltransferase OS=Nitrosomonas eutropha (strain C91) GN=argF PE=3 SV=1 31 355 3.0E-52
sp|Q2KZD0|OTC_BORA1 Ornithine carbamoyltransferase OS=Bordetella avium (strain 197N) GN=argF PE=3 SV=1 31 346 3.0E-52
sp|Q740I5|OTC_MYCPA Ornithine carbamoyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=argF PE=3 SV=1 30 345 3.0E-52
sp|A0QHB0|OTC_MYCA1 Ornithine carbamoyltransferase OS=Mycobacterium avium (strain 104) GN=argF PE=3 SV=1 30 345 4.0E-52
sp|Q9A653|OTC_CAUCR Ornithine carbamoyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argF PE=3 SV=1 29 345 6.0E-52
sp|Q46XK9|OTC_CUPPJ Ornithine carbamoyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=argF PE=3 SV=1 31 346 9.0E-52
sp|C1ASZ8|OTC_RHOOB Ornithine carbamoyltransferase OS=Rhodococcus opacus (strain B4) GN=arcB PE=3 SV=1 31 345 9.0E-52
sp|O27495|OTC_METTH Ornithine carbamoyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argF PE=3 SV=1 31 345 2.0E-51
sp|Q8RCA4|OTC_CALS4 Ornithine carbamoyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argF PE=3 SV=1 29 345 3.0E-51
sp|Q7VTJ8|OTC_BORPE Ornithine carbamoyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argF PE=3 SV=1 31 346 4.0E-51
sp|Q7W7H7|OTC_BORPA Ornithine carbamoyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argF PE=3 SV=1 31 346 4.0E-51
sp|Q7WKW6|OTC_BORBR Ornithine carbamoyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argF PE=3 SV=1 31 346 4.0E-51
sp|Q5N1N8|OTC_SYNP6 Ornithine carbamoyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argF PE=3 SV=1 31 345 5.0E-51
sp|Q935Y4|OTC_SYNE7 Ornithine carbamoyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=argF PE=3 SV=5 31 345 5.0E-51
sp|Q1LJA1|OTC_CUPMC Ornithine carbamoyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=argF PE=3 SV=1 31 346 6.0E-51
sp|Q7NGR7|OTC_GLOVI Ornithine carbamoyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=argF PE=1 SV=1 70 345 7.0E-51
sp|Q725C8|PTC_LISMF Putrescine carbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ptcA PE=3 SV=1 29 349 8.0E-51
sp|C1KV77|PTC_LISMC Putrescine carbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=ptcA PE=3 SV=1 29 349 8.0E-51
sp|Q6GDG8|OTCC_STAAR Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain MRSA252) GN=arcB PE=3 SV=1 29 345 1.0E-50
sp|O87319|OTC_NOSP7 Ornithine carbamoyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=argF PE=3 SV=2 31 345 1.0E-50
sp|Q5P0Z8|OTC_AROAE Ornithine carbamoyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=argF PE=3 SV=1 29 352 2.0E-50
sp|A1K7J9|OTC_AZOSB Ornithine carbamoyltransferase OS=Azoarcus sp. (strain BH72) GN=arcB PE=3 SV=1 30 355 2.0E-50
sp|Q03HM9|PTC_PEDPA Putrescine carbamoyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ptcA PE=3 SV=1 31 345 2.0E-50
sp|A1TLB7|OTC_ACIAC Ornithine carbamoyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=argF PE=3 SV=1 31 346 2.0E-50
sp|Q7UQZ6|OTC_RHOBA Ornithine carbamoyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=argF PE=3 SV=1 31 345 2.0E-50
sp|Q0SI56|OTC_RHOJR Ornithine carbamoyltransferase OS=Rhodococcus jostii (strain RHA1) GN=argF PE=3 SV=1 31 345 3.0E-50
sp|A4G3H2|OTC_HERAR Ornithine carbamoyltransferase OS=Herminiimonas arsenicoxydans GN=argF PE=3 SV=1 31 352 3.0E-50
sp|Q48296|OTCC_HALSA Ornithine carbamoyltransferase, catabolic OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arcB PE=1 SV=1 31 349 4.0E-50
sp|P65602|OTCC_STAAN Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain N315) GN=arcB PE=1 SV=1 29 345 5.0E-50
sp|P65601|OTCC_STAAM Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arcB PE=3 SV=1 29 345 5.0E-50
sp|Q8YAS7|PTC_LISMO Putrescine carbamoyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ptcA PE=3 SV=1 29 349 6.0E-50
sp|Q8NUK8|OTCC_STAAW Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain MW2) GN=arcB PE=3 SV=1 29 345 8.0E-50
sp|Q6G640|OTCC_STAAS Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain MSSA476) GN=arcB PE=3 SV=1 29 345 8.0E-50
sp|Q5HCR3|OTCC_STAAC Ornithine carbamoyltransferase, catabolic OS=Staphylococcus aureus (strain COL) GN=arcB PE=3 SV=1 29 345 8.0E-50
sp|Q2NI83|OTC_METST Ornithine carbamoyltransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=argF PE=3 SV=1 31 345 8.0E-50
sp|B3R6D6|OTC_CUPTR Ornithine carbamoyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=arcB PE=3 SV=1 31 346 1.0E-49
sp|Q47BL9|OTC_DECAR Ornithine carbamoyltransferase OS=Dechloromonas aromatica (strain RCB) GN=argF PE=3 SV=1 31 355 2.0E-49
sp|Q7VAW6|OTC_PROMA Ornithine carbamoyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argF PE=3 SV=1 31 338 3.0E-49
sp|Q8YMM6|OTC_NOSS1 Ornithine carbamoyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argF PE=3 SV=1 31 345 3.0E-49
sp|A8LE44|OTC_FRASN Ornithine carbamoyltransferase OS=Frankia sp. (strain EAN1pec) GN=argF PE=3 SV=1 31 345 4.0E-49
sp|Q8KDE2|OTC_CHLTE Ornithine carbamoyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argF PE=3 SV=1 74 351 4.0E-49
sp|Q3MB19|OTC_ANAVT Ornithine carbamoyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=argF PE=3 SV=1 31 345 4.0E-49
sp|Q55497|OTC_SYNY3 Ornithine carbamoyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argF PE=3 SV=1 31 345 5.0E-49
sp|A6UNM1|OTC_METVS Ornithine carbamoyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=argF PE=3 SV=1 71 346 5.0E-49
sp|Q8EK29|OTC_SHEON Ornithine carbamoyltransferase OS=Shewanella oneidensis (strain MR-1) GN=argF PE=3 SV=1 31 345 5.0E-49
sp|Q1H0L0|OTC_METFK Ornithine carbamoyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=argF PE=3 SV=1 31 355 8.0E-49
sp|A0PP77|OTC_MYCUA Ornithine carbamoyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=argF PE=3 SV=1 31 354 2.0E-48
sp|Q6AGC9|OTC_LEIXX Ornithine carbamoyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=argF PE=3 SV=1 71 345 2.0E-48
sp|P59778|OTC_BIFLO Ornithine carbamoyltransferase OS=Bifidobacterium longum (strain NCC 2705) GN=argF PE=3 SV=1 31 345 2.0E-48
sp|O86132|OTCC_BACLD Ornithine carbamoyltransferase, catabolic OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=arcB PE=3 SV=1 71 345 3.0E-48
sp|B7GTP2|OTC_BIFLS Ornithine carbamoyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=arcB PE=3 SV=1 31 345 3.0E-48
sp|Q3A1V3|OTC_PELCD Ornithine carbamoyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=argF PE=3 SV=1 31 345 5.0E-48
sp|Q9RY70|OTC_DEIRA Ornithine carbamoyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=argF PE=3 SV=2 31 345 6.0E-48
sp|Q03NG2|PTC_LACBA Putrescine carbamoyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ptcA PE=3 SV=1 31 345 7.0E-48
sp|Q9CC11|OTC_MYCLE Ornithine carbamoyltransferase OS=Mycobacterium leprae (strain TN) GN=argF PE=3 SV=2 31 345 7.0E-48
sp|Q7B9Y6|PTC_LACBR Putrescine carbamoyltransferase OS=Lactobacillus brevis GN=ptcA PE=3 SV=2 31 345 7.0E-48
sp|B2UML6|OTC_AKKM8 Ornithine carbamoyltransferase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=arcB PE=3 SV=1 32 345 8.0E-48
sp|A5CSJ2|OTC_CLAM3 Ornithine carbamoyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=argF PE=3 SV=1 31 345 1.0E-47
sp|Q8DJW4|OTC_THEEB Ornithine carbamoyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=argF PE=3 SV=1 22 350 1.0E-47
sp|Q9K4Z4|OTC_MORPR Ornithine carbamoyltransferase OS=Moritella profunda GN=argF PE=3 SV=1 31 345 2.0E-47
sp|Q9K575|OTCC_LACLM Ornithine carbamoyltransferase, catabolic OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=arcB PE=3 SV=1 26 345 2.0E-47
sp|P9WIT9|OTC_MYCTU Ornithine carbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=argF PE=1 SV=1 31 345 3.0E-47
sp|P9WIT8|OTC_MYCTO Ornithine carbamoyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=argF PE=3 SV=1 31 345 3.0E-47
sp|A5U313|OTC_MYCTA Ornithine carbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=argF PE=3 SV=1 31 345 3.0E-47
sp|A1KJ73|OTC_MYCBP Ornithine carbamoyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=argF PE=3 SV=1 31 345 3.0E-47
sp|P0A5M9|OTC_MYCBO Ornithine carbamoyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=argF PE=1 SV=1 31 345 3.0E-47
sp|A9WQ88|OTC_RENSM Ornithine carbamoyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=argF PE=3 SV=1 31 349 3.0E-47
sp|P0C2U0|OTCC_LACLA Ornithine carbamoyltransferase, catabolic OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=arcB PE=3 SV=1 26 345 4.0E-47
sp|B0RHD4|OTC_CLAMS Ornithine carbamoyltransferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=argF PE=3 SV=1 31 345 6.0E-47
sp|P57876|OTC_PASMU Ornithine carbamoyltransferase OS=Pasteurella multocida (strain Pm70) GN=argF PE=3 SV=1 29 345 7.0E-47
sp|P0C2U1|OTCC_LACLC Ornithine carbamoyltransferase, catabolic OS=Lactococcus lactis subsp. cremoris GN=arcB PE=3 SV=1 26 345 7.0E-47
sp|Q6TK73|OTCC_STRRT Ornithine carbamoyltransferase, catabolic OS=Streptococcus ratti GN=arcB PE=3 SV=1 28 345 2.0E-46
sp|P96172|OTC_VIBS2 Ornithine carbamoyltransferase OS=Vibrio sp. (strain 2693) GN=argF PE=3 SV=2 31 345 2.0E-46
sp|B5E3F8|OTC_STRP4 Ornithine carbamoyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=arcB PE=3 SV=1 26 345 7.0E-46
sp|C1CU67|OTC_STRZT Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=arcB PE=3 SV=1 26 345 9.0E-46
sp|C1CHE7|OTC_STRZJ Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=arcB PE=3 SV=1 26 345 9.0E-46
sp|B2INH0|OTC_STRPS Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=arcB PE=3 SV=1 26 345 9.0E-46
sp|B8ZPY8|OTC_STRPJ Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=arcB PE=3 SV=1 26 345 9.0E-46
sp|B1I9W1|OTC_STRPI Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=arcB PE=3 SV=1 26 345 9.0E-46
sp|C1CAZ4|OTC_STRP7 Ornithine carbamoyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=arcB PE=3 SV=1 26 345 9.0E-46
sp|Q04I25|OTC_STRP2 Ornithine carbamoyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=arcB PE=3 SV=1 26 345 9.0E-46
sp|P65608|OTCC_STRR6 Ornithine carbamoyltransferase, catabolic OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=arcB PE=3 SV=1 26 345 9.0E-46
sp|P65607|OTCC_STRPN Ornithine carbamoyltransferase, catabolic OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=arcB PE=3 SV=1 26 345 9.0E-46
sp|Q1GIW7|OTC_RUEST Ornithine carbamoyltransferase OS=Ruegeria sp. (strain TM1040) GN=argF PE=3 SV=1 32 345 1.0E-45
sp|Q38ZL1|PTC_LACSS Putrescine carbamoyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ptcA PE=3 SV=1 31 345 1.0E-45
sp|Q9K4Y9|OTC_MORAB Ornithine carbamoyltransferase OS=Moritella abyssi GN=argF PE=1 SV=1 31 345 2.0E-45
sp|A6TWW1|OTC_ALKMQ Ornithine carbamoyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=argF PE=3 SV=1 29 345 3.0E-45
sp|Q5LUT9|OTC_RUEPO Ornithine carbamoyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=argF PE=3 SV=1 32 345 3.0E-45
sp|Q0SM07|OTC_BORAP Ornithine carbamoyltransferase OS=Borrelia afzelii (strain PKo) GN=arcB PE=3 SV=1 29 345 3.0E-45
sp|O51897|OTCC_BORAF Ornithine carbamoyltransferase, catabolic OS=Borrelia afzelii GN=arcB PE=3 SV=1 29 345 3.0E-45
sp|Q8CMW2|OTCC2_STAES Ornithine carbamoyltransferase 2, catabolic OS=Staphylococcus epidermidis (strain ATCC 12228) GN=arcB2 PE=3 SV=1 29 345 7.0E-45
sp|O53089|OTCC_LACSK Ornithine carbamoyltransferase, catabolic OS=Lactobacillus sakei GN=arcB PE=3 SV=1 26 345 1.0E-44
sp|A4VU03|OTC_STRSY Ornithine carbamoyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=arcB PE=3 SV=1 26 345 2.0E-44
sp|A4W094|OTC_STRS2 Ornithine carbamoyltransferase OS=Streptococcus suis (strain 98HAH33) GN=arcB PE=3 SV=1 26 345 2.0E-44
sp|Q8GG79|OTCC_STRSU Ornithine carbamoyltransferase, catabolic OS=Streptococcus suis GN=arcB PE=3 SV=2 26 345 2.0E-44
sp|A1RVH4|OTC_PYRIL Ornithine carbamoyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=argF PE=3 SV=1 31 345 3.0E-44
sp|Q8FAE1|OTCC_ECOL6 Ornithine carbamoyltransferase, catabolic OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=arcB PE=3 SV=2 25 345 3.0E-44
sp|Q81II0|OTCC_BACCR Ornithine carbamoyltransferase, catabolic OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=arcB PE=3 SV=1 29 345 4.0E-44
sp|Q7U5V5|OTC_SYNPX Ornithine carbamoyltransferase OS=Synechococcus sp. (strain WH8102) GN=argF PE=3 SV=1 31 345 5.0E-44
sp|B5XMC1|OTC_STRPZ Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=arcB PE=3 SV=1 28 345 5.0E-44
sp|A2RDJ1|OTC_STRPG Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=arcB PE=3 SV=1 28 345 5.0E-44
sp|Q1J5Q6|OTC_STRPF Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=arcB PE=3 SV=1 28 345 5.0E-44
sp|Q1JFZ1|OTC_STRPD Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=arcB PE=3 SV=1 28 345 5.0E-44
sp|Q1JKW5|OTC_STRPC Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=arcB PE=3 SV=1 28 345 5.0E-44
sp|Q1JAR4|OTC_STRPB Ornithine carbamoyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=arcB PE=3 SV=1 28 345 5.0E-44
sp|P0DC83|OTCC_STRPQ Ornithine carbamoyltransferase, catabolic OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=arcB PE=3 SV=1 28 345 5.0E-44
sp|P65610|OTCC_STRP8 Ornithine carbamoyltransferase, catabolic OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=arcB PE=3 SV=2 28 345 5.0E-44
sp|Q5XAY4|OTCC_STRP6 Ornithine carbamoyltransferase, catabolic OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=arcB PE=1 SV=3 28 345 5.0E-44
sp|P0DC82|OTCC_STRP3 Ornithine carbamoyltransferase, catabolic OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=arcB PE=3 SV=1 28 345 5.0E-44
sp|P0C0D0|OTCC_STRP1 Ornithine carbamoyltransferase, catabolic OS=Streptococcus pyogenes serotype M1 GN=arcB PE=3 SV=3 28 345 5.0E-44
sp|A3MWJ5|OTC_PYRCJ Ornithine carbamoyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=argF PE=3 SV=1 31 345 5.0E-44
sp|Q73E86|OTCC_BACC1 Ornithine carbamoyltransferase, catabolic OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=arcB PE=3 SV=1 29 345 5.0E-44
sp|O08322|OTC_LACPL Ornithine carbamoyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argF PE=3 SV=2 26 345 7.0E-44
sp|Q7V0J3|OTC_PROMP Ornithine carbamoyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argF PE=3 SV=1 31 345 8.0E-44
sp|C3LR49|OTC_VIBCM Ornithine carbamoyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=arcB PE=3 SV=1 29 345 9.0E-44
sp|Q9KP68|OTC_VIBCH Ornithine carbamoyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argF PE=3 SV=1 29 345 9.0E-44
sp|Q6HP28|OTCC_BACHK Ornithine carbamoyltransferase, catabolic OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=arcB PE=3 SV=1 29 345 9.0E-44
sp|Q3J4X5|OTC_RHOS4 Ornithine carbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=argF PE=3 SV=1 32 345 1.0E-43
sp|A3PHL6|OTC_RHOS1 Ornithine carbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=argF PE=3 SV=1 32 345 1.0E-43
sp|B9KMW0|OTC_RHOSK Ornithine carbamoyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=arcB PE=3 SV=1 32 345 2.0E-43
sp|Q8GND4|OTCC_STRGC Ornithine carbamoyltransferase, catabolic OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=arcB PE=3 SV=1 26 345 2.0E-43
sp|B9DUY9|OTC_STRU0 Ornithine carbamoyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=arcB PE=3 SV=1 28 345 3.0E-43
sp|P57449|OTC_BUCAI Ornithine carbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argI PE=3 SV=1 31 345 3.0E-43
sp|B8D7Q5|OTC_BUCAT Ornithine carbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=arcB PE=3 SV=1 31 345 4.0E-43
sp|B8D9F3|OTC_BUCA5 Ornithine carbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=arcB PE=3 SV=1 31 345 5.0E-43
sp|Q8G998|OTCC_LACHI Ornithine carbamoyltransferase, catabolic OS=Lactobacillus hilgardii GN=arcB PE=1 SV=1 26 345 7.0E-43
sp|A7MSD8|OTC_VIBCB Ornithine carbamoyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=argF PE=3 SV=1 29 345 8.0E-43
sp|A9ERU2|OTC_SORC5 Ornithine carbamoyltransferase OS=Sorangium cellulosum (strain So ce56) GN=argF PE=3 SV=1 31 338 1.0E-42
sp|Q839Q5|OTCC_ENTFA Ornithine carbamoyltransferase, catabolic OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=arcB PE=3 SV=1 26 345 1.0E-42
sp|Q8RP83|OTCC_STRAG Ornithine carbamoyltransferase, catabolic OS=Streptococcus agalactiae GN=arcB PE=3 SV=1 28 345 1.0E-42
sp|Q169P2|OTC_ROSDO Ornithine carbamoyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=argF PE=3 SV=1 32 345 2.0E-42
sp|P59100|OTC_BUCAP Ornithine carbamoyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argI PE=3 SV=1 31 345 2.0E-42
sp|B7J0T6|OTC_BORBZ Ornithine carbamoyltransferase OS=Borrelia burgdorferi (strain ZS7) GN=arcB PE=3 SV=1 29 345 2.0E-42
sp|O51782|OTCC_BORBU Ornithine carbamoyltransferase, catabolic OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=arcB PE=3 SV=2 29 345 2.0E-42
sp|P65606|OTCC2_STRA5 Ornithine carbamoyltransferase 2, catabolic OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=arcB2 PE=3 SV=1 28 345 3.0E-42
sp|P65605|OTCC2_STRA3 Ornithine carbamoyltransferase 2, catabolic OS=Streptococcus agalactiae serotype III (strain NEM316) GN=arcB2 PE=3 SV=1 28 345 3.0E-42
sp|Q87LF9|OTC_VIBPA Ornithine carbamoyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argF PE=3 SV=1 29 345 3.0E-42
sp|Q7MZ18|OTC_PHOLL Ornithine carbamoyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argI PE=3 SV=1 28 345 3.0E-42
sp|C0MBK6|OTC_STRE4 Ornithine carbamoyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=arcB PE=3 SV=1 28 345 3.0E-42
sp|Q89AG1|OTC_BUCBP Ornithine carbamoyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=argI PE=3 SV=1 26 345 5.0E-42
sp|Q03NY9|OTC_LACBA Ornithine carbamoyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=arcB PE=3 SV=1 26 345 5.0E-42
sp|Q6LUW9|OTCC_PHOPR Ornithine carbamoyltransferase, catabolic OS=Photobacterium profundum GN=arcB PE=3 SV=1 29 345 6.0E-42
sp|A1B3N7|OTC_PARDP Ornithine carbamoyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=argF PE=3 SV=1 33 345 7.0E-42
sp|Q8ZK35|OTCC_SALTY Ornithine carbamoyltransferase, catabolic OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=arcB PE=3 SV=1 29 345 8.0E-42
sp|Q8Z127|OTCC_SALTI Ornithine carbamoyltransferase, catabolic OS=Salmonella typhi GN=arcB PE=3 SV=1 29 345 8.0E-42
sp|Q65ZT0|OTCC_BORBP Ornithine carbamoyltransferase, catabolic OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=arcB PE=3 SV=1 29 345 1.0E-41
sp|C0MD77|OTC_STRS7 Ornithine carbamoyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=arcB PE=3 SV=1 28 345 2.0E-41
sp|B4U1S2|OTC_STREM Ornithine carbamoyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=arcB PE=3 SV=1 28 345 2.0E-41
sp|Q319M8|OTC_PROM9 Ornithine carbamoyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=argF PE=3 SV=1 32 349 2.0E-41
sp|Q8ZW40|OTC_PYRAE Ornithine carbamoyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=argF PE=3 SV=3 31 345 4.0E-41
sp|B0BQQ2|OTC_ACTPJ Ornithine carbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=arcB PE=3 SV=1 29 345 4.0E-41
sp|B3GY96|OTC_ACTP7 Ornithine carbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=arcB PE=3 SV=1 29 345 4.0E-41
sp|A3N1W5|OTC_ACTP2 Ornithine carbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=argF PE=3 SV=1 29 345 4.0E-41
sp|Q97M82|OTC_CLOAB Ornithine carbamoyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argF PE=3 SV=1 29 345 6.0E-41
sp|Q6AA77|OTC_PROAC Ornithine carbamoyltransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=argF PE=3 SV=1 29 345 8.0E-41
sp|Q65TN0|OTC_MANSM Ornithine carbamoyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=argF PE=3 SV=1 29 345 1.0E-40
sp|Q63U72|OTCC_BURPS Ornithine carbamoyltransferase, catabolic OS=Burkholderia pseudomallei (strain K96243) GN=arcB PE=3 SV=1 31 345 2.0E-40
sp|Q92ZT1|OTCC_RHIME Ornithine carbamoyltransferase, catabolic OS=Rhizobium meliloti (strain 1021) GN=arcB PE=3 SV=1 29 345 2.0E-40
sp|Q0SWK5|OTC_CLOPS Ornithine carbamoyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=arcB PE=3 SV=1 29 345 3.0E-40
sp|Q62KD8|OTCC_BURMA Ornithine carbamoyltransferase, catabolic OS=Burkholderia mallei (strain ATCC 23344) GN=arcB PE=3 SV=1 31 345 3.0E-40
sp|P0C2E4|OTCC_CLOPE Ornithine carbamoyltransferase, catabolic OS=Clostridium perfringens (strain 13 / Type A) GN=arcB PE=3 SV=1 29 345 3.0E-40
sp|Q0TUR4|OTCC_CLOP1 Ornithine carbamoyltransferase, catabolic OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=arcB PE=3 SV=1 29 345 3.0E-40
sp|Q7V8G9|OTC_PROMM Ornithine carbamoyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=argF PE=3 SV=1 29 345 3.0E-40
sp|Q0T9E0|OTC_ECOL5 Ornithine carbamoyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=argI PE=3 SV=1 25 317 7.0E-40
sp|Q9ZIX8|OTCC_AVIPA Ornithine carbamoyltransferase, catabolic OS=Avibacterium paragallinarum GN=arcB PE=3 SV=1 29 345 7.0E-40
sp|A4TQQ1|OTC_YERPP Ornithine carbamoyltransferase OS=Yersinia pestis (strain Pestoides F) GN=argI PE=3 SV=1 26 345 8.0E-40
sp|Q1CM06|OTC_YERPN Ornithine carbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=argI PE=3 SV=1 26 345 8.0E-40
sp|Q8ZBG8|OTC_YERPE Ornithine carbamoyltransferase OS=Yersinia pestis GN=argI PE=3 SV=1 26 345 8.0E-40
sp|Q7MHF2|OTC_VIBVY Ornithine carbamoyltransferase OS=Vibrio vulnificus (strain YJ016) GN=argF PE=3 SV=1 29 345 1.0E-39
sp|Q5E7U4|OTC_VIBF1 Ornithine carbamoyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=argF PE=3 SV=1 29 345 2.0E-39
sp|Q9CHD1|OTC_LACLA Ornithine carbamoyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argF PE=3 SV=1 28 338 3.0E-39
sp|Q08016|OTC_SALTY Ornithine carbamoyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argI PE=3 SV=3 26 345 4.0E-39
sp|Q8VW55|OTCC_OENOE Ornithine carbamoyltransferase, catabolic OS=Oenococcus oeni GN=arcB PE=3 SV=1 26 345 5.0E-39
sp|B7MLQ9|OTC_ECO45 Ornithine carbamoyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=argI PE=3 SV=1 26 345 5.0E-39
sp|Q8DCF5|OTC_VIBVU Ornithine carbamoyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=argF PE=1 SV=1 29 345 6.0E-39
sp|A7ZVD3|OTC_ECO24 Ornithine carbamoyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=argI PE=3 SV=1 26 345 6.0E-39
sp|A5I524|OTC_CLOBH Ornithine carbamoyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=arcB PE=3 SV=1 29 345 7.0E-39
sp|A7FWM4|OTC_CLOB1 Ornithine carbamoyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=arcB PE=3 SV=1 29 345 7.0E-39
sp|Q9JTI4|OTC_NEIMA Ornithine carbamoyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argF PE=3 SV=1 29 345 7.0E-39
sp|A5UHA3|OTC_HAEIG Ornithine carbamoyltransferase OS=Haemophilus influenzae (strain PittGG) GN=arcB PE=3 SV=1 29 345 7.0E-39
sp|Q3YU98|OTC_SHISS Ornithine carbamoyltransferase OS=Shigella sonnei (strain Ss046) GN=argI PE=3 SV=1 26 345 8.0E-39
sp|Q73P70|OTCC_TREDE Ornithine carbamoyltransferase, catabolic OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=arcB PE=3 SV=1 25 345 9.0E-39
sp|A7FMM5|OTC_YERP3 Ornithine carbamoyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=argI PE=3 SV=1 26 345 9.0E-39
sp|Q0SXJ4|OTC_SHIF8 Ornithine carbamoyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=argI PE=3 SV=1 26 345 9.0E-39
sp|Q66F14|OTC_YERPS Ornithine carbamoyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argI PE=3 SV=1 26 345 1.0E-38
sp|Q88P53|OTCC_PSEPK Ornithine carbamoyltransferase, catabolic OS=Pseudomonas putida (strain KT2440) GN=arcB PE=3 SV=3 31 345 1.0E-38
sp|B1IJJ6|OTC_CLOBK Ornithine carbamoyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=arcB PE=3 SV=1 29 345 1.0E-38
sp|B1KXQ3|OTC_CLOBM Ornithine carbamoyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=arcB PE=3 SV=1 29 345 1.0E-38
sp|A7GGI0|OTC_CLOBL Ornithine carbamoyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=arcB PE=3 SV=1 29 345 1.0E-38
sp|Q5F7E6|OTC_NEIG1 Ornithine carbamoyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=argF PE=3 SV=1 29 345 1.0E-38
sp|P04391|OTC1_ECOLI Ornithine carbamoyltransferase chain I OS=Escherichia coli (strain K12) GN=argI PE=1 SV=3 26 345 1.0E-38
sp|C3L179|OTC_CLOB6 Ornithine carbamoyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=arcB PE=3 SV=1 29 345 1.0E-38
sp|O31018|OTCC_RHIET Ornithine carbamoyltransferase, catabolic OS=Rhizobium etli GN=arcB PE=3 SV=1 29 345 1.0E-38
sp|Q8Z123|OTC_SALTI Ornithine carbamoyltransferase OS=Salmonella typhi GN=argI PE=3 SV=3 26 345 1.0E-38
sp|P44770|OTCC_HAEIN Ornithine carbamoyltransferase, catabolic OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=arcB PE=3 SV=1 29 345 2.0E-38
sp|E6N013|OTC_NEIMH Ornithine carbamoyltransferase OS=Neisseria meningitidis serogroup B / serotype 15 (strain H44/76) GN=argF PE=3 SV=1 29 345 2.0E-38
sp|P0DH57|OTC_NEIMB Ornithine carbamoyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argF PE=3 SV=1 29 345 2.0E-38
sp|P68747|OTC2_PSESH Ornithine carbamoyltransferase 2, phaseolotoxin-insensitive OS=Pseudomonas savastanoi pv. phaseolicola GN=argK PE=1 SV=2 26 345 2.0E-38
sp|P68746|OTC2_PSESF Ornithine carbamoyltransferase 2, phaseolotoxin-insensitive OS=Pseudomonas syringae pv. actinidiae GN=argK PE=3 SV=2 26 345 2.0E-38
sp|C1FTE9|OTC_CLOBJ Ornithine carbamoyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=arcB PE=3 SV=1 29 345 2.0E-38
sp|P21302|OTC_NEIGO Ornithine carbamoyltransferase OS=Neisseria gonorrhoeae GN=argF PE=3 SV=1 29 345 3.0E-38
sp|Q8FAD6|OTC_ECOL6 Ornithine carbamoyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argI PE=3 SV=3 26 345 4.0E-38
sp|P08308|OTCC_PSEAE Ornithine carbamoyltransferase, catabolic OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=arcB PE=1 SV=3 31 345 4.0E-38
sp|B7NGI6|OTC_ECOLU Ornithine carbamoyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=argI PE=3 SV=1 26 345 4.0E-38
sp|B1ISV4|OTC_ECOLC Ornithine carbamoyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=argI PE=3 SV=1 26 345 4.0E-38
sp|A8A810|OTC_ECOHS Ornithine carbamoyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=argI PE=3 SV=1 26 345 4.0E-38
sp|B7M9L3|OTC_ECO8A Ornithine carbamoyltransferase OS=Escherichia coli O8 (strain IAI1) GN=argI PE=3 SV=1 26 345 4.0E-38
sp|B7LCW4|OTC_ECO55 Ornithine carbamoyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=argI PE=3 SV=1 26 345 4.0E-38
sp|Q83IM2|OTC_SHIFL Ornithine carbamoyltransferase OS=Shigella flexneri GN=argI PE=3 SV=1 26 345 4.0E-38
sp|Q47NE4|OTC_THEFY Ornithine carbamoyltransferase OS=Thermobifida fusca (strain YX) GN=argF PE=3 SV=1 29 338 7.0E-38
sp|A1KUZ7|OTC_NEIMF Ornithine carbamoyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=argF PE=3 SV=1 29 345 7.0E-38
sp|Q8XCB8|OTC_ECO57 Ornithine carbamoyltransferase OS=Escherichia coli O157:H7 GN=argI PE=3 SV=3 26 345 9.0E-38
sp|B2VL36|OTC_ERWT9 Ornithine carbamoyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=argI PE=3 SV=1 26 345 1.0E-37
sp|Q8DVC9|OTC_STRMU Ornithine carbamoyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argF PE=3 SV=1 73 345 1.0E-37
sp|Q328S8|OTC_SHIDS Ornithine carbamoyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=argI PE=3 SV=1 26 345 2.0E-37
sp|Q31TJ4|OTC_SHIBS Ornithine carbamoyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=argI PE=3 SV=1 26 345 2.0E-37
sp|Q6DA71|OTC_PECAS Ornithine carbamoyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argI PE=3 SV=1 28 345 2.0E-37
sp|P59779|OTCC_MYCCC Ornithine carbamoyltransferase, catabolic OS=Mycoplasma capricolum subsp. capripneumoniae GN=arcB PE=3 SV=1 29 331 5.0E-37
sp|Q8CU41|OTCC1_STAES Ornithine carbamoyltransferase 1, catabolic OS=Staphylococcus epidermidis (strain ATCC 12228) GN=arcB1 PE=3 SV=1 29 345 6.0E-37
sp|Q4L9V8|OTC_STAHJ Ornithine carbamoyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=argF PE=3 SV=1 29 345 1.0E-36
sp|A0KQG4|OTC_AERHH Ornithine carbamoyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=argF PE=3 SV=1 29 345 3.0E-36
sp|Q7VQT3|OTC_BLOFL Ornithine carbamoyltransferase OS=Blochmannia floridanus GN=Bfl032 PE=3 SV=1 31 345 3.0E-36
sp|P0C0N1|OTC_STAES Ornithine carbamoyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argF PE=3 SV=1 29 345 5.0E-36
sp|Q7VP68|OTC_HAEDU Ornithine carbamoyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=argF PE=3 SV=1 29 345 7.0E-36
sp|A4SHP4|OTC_AERS4 Ornithine carbamoyltransferase OS=Aeromonas salmonicida (strain A449) GN=argF PE=3 SV=1 29 345 2.0E-35
sp|P06960|OTC2_ECOLI Ornithine carbamoyltransferase chain F OS=Escherichia coli (strain K12) GN=argF PE=1 SV=4 31 345 3.0E-35
sp|Q8F2D1|OTC_LEPIN Ornithine carbamoyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=argF PE=3 SV=1 71 345 3.0E-35
sp|Q72T26|OTC_LEPIC Ornithine carbamoyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=argF PE=3 SV=1 71 345 3.0E-35
sp|Q8NX44|OTC_STAAW Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain MW2) GN=argF PE=3 SV=1 29 345 4.0E-35
sp|Q6GA45|OTC_STAAS Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=argF PE=3 SV=1 29 345 4.0E-35
sp|P0C6P3|OTC_STAAU Ornithine carbamoyltransferase OS=Staphylococcus aureus GN=argF PE=3 SV=1 29 345 5.0E-35
sp|Q6GHR7|OTC_STAAR Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=argF PE=3 SV=1 29 345 5.0E-35
sp|P99073|OTC_STAAN Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain N315) GN=argF PE=1 SV=1 29 345 5.0E-35
sp|P0A099|OTC_STAAM Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=argF PE=3 SV=1 29 345 5.0E-35
sp|A6QG68|OTC_STAAE Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain Newman) GN=argF PE=3 SV=2 29 345 5.0E-35
sp|Q5HGR3|OTC_STAAC Ornithine carbamoyltransferase OS=Staphylococcus aureus (strain COL) GN=argF PE=3 SV=1 29 345 5.0E-35
sp|Q7NRK0|OTCC_CHRVO Ornithine carbamoyltransferase, catabolic OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=arcB PE=3 SV=1 29 345 5.0E-35
sp|B2G653|OTC_LACRJ Ornithine carbamoyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=arcB PE=3 SV=1 29 345 6.0E-35
sp|A5VIM0|OTC_LACRD Ornithine carbamoyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=arcB PE=3 SV=1 29 345 6.0E-35
sp|Q93JF1|OTC_STRCO Ornithine carbamoyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argF PE=3 SV=1 31 345 2.0E-34
sp|P65604|OTCC1_STRA5 Ornithine carbamoyltransferase 1, catabolic OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=arcB1 PE=3 SV=1 29 345 2.0E-34
sp|P65603|OTCC1_STRA3 Ornithine carbamoyltransferase 1, catabolic OS=Streptococcus agalactiae serotype III (strain NEM316) GN=arcB1 PE=3 SV=1 29 345 2.0E-34
sp|Q936V7|OTCC_PSEME Ornithine carbamoyltransferase, catabolic OS=Pseudomonas mendocina GN=arcB PE=3 SV=3 31 345 3.0E-34
sp|Q03DS0|OTC_PEDPA Ornithine carbamoyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=arcB PE=3 SV=1 29 345 1.0E-33
sp|Q6LG09|OTC_PHOPR Ornithine carbamoyltransferase OS=Photobacterium profundum GN=argF PE=3 SV=1 29 345 2.0E-33
sp|Q8EVF5|OTCC_MYCPE Ornithine carbamoyltransferase, catabolic OS=Mycoplasma penetrans (strain HF-2) GN=arcB PE=1 SV=1 29 345 3.0E-33
sp|Q01322|OTC_NEICI Ornithine carbamoyltransferase (Fragment) OS=Neisseria cinerea GN=argF PE=3 SV=1 82 334 6.0E-32
sp|P75473|OTCC_MYCPN Ornithine carbamoyltransferase, catabolic OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=arcB PE=3 SV=2 71 345 3.0E-31
sp|Q01324|OTC_NEILA Ornithine carbamoyltransferase (Fragment) OS=Neisseria lactamica GN=argF PE=3 SV=1 82 334 5.0E-31
sp|Q01325|OTC_NEIME Ornithine carbamoyltransferase (Fragment) OS=Neisseria meningitidis GN=argF PE=3 SV=2 82 334 1.0E-30
sp|Q82KQ4|OTC_STRAW Ornithine carbamoyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argF PE=3 SV=1 26 345 1.0E-30
sp|Q01323|OTC_NEIFL Ornithine carbamoyltransferase (Fragment) OS=Neisseria flavescens GN=argF PE=3 SV=1 82 334 6.0E-30
sp|Q01326|OTC_NEIMU Ornithine carbamoyltransferase (Fragment) OS=Neisseria mucosa GN=argF PE=3 SV=1 82 334 4.0E-29
sp|Q01327|OTC_NEIPO Ornithine carbamoyltransferase (Fragment) OS=Neisseria polysaccharea GN=argF PE=3 SV=1 82 334 6.0E-29
sp|O86412|OTC_NEISI Ornithine carbamoyltransferase (Fragment) OS=Neisseria sicca GN=argF PE=3 SV=1 99 312 3.0E-26
sp|O86385|OTC_NEIFV Ornithine carbamoyltransferase (Fragment) OS=Neisseria flava GN=argF PE=3 SV=1 111 312 3.0E-26
sp|O86415|OTC_NEISU Ornithine carbamoyltransferase (Fragment) OS=Neisseria subflava GN=argF PE=3 SV=1 99 312 4.0E-26
sp|O86408|OTC_NEIPH Ornithine carbamoyltransferase (Fragment) OS=Neisseria pharyngis GN=argF PE=3 SV=1 99 312 8.0E-26
sp|Q9R3D1|OTC_NEIEL Ornithine carbamoyltransferase (Fragment) OS=Neisseria elongata GN=argF PE=3 SV=1 99 312 9.0E-25
sp|Q2FN12|PYRB_METHJ Aspartate carbamoyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pyrB PE=3 SV=1 32 350 1.0E-23
sp|O86404|OTC_NEIPE Ornithine carbamoyltransferase (Fragment) OS=Neisseria perflava GN=argF PE=3 SV=1 99 312 1.0E-22
sp|O86376|OTC_NEIAN Ornithine carbamoyltransferase (Fragment) OS=Neisseria animalis GN=argF PE=3 SV=1 99 312 4.0E-22
sp|A0KQG0|PYRB_AERHH Aspartate carbamoyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pyrB PE=3 SV=2 31 345 4.0E-22
sp|A4SHP8|PYRB_AERS4 Aspartate carbamoyltransferase OS=Aeromonas salmonicida (strain A449) GN=pyrB PE=3 SV=1 31 345 2.0E-21
sp|A9M469|PYRB_NEIM0 Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pyrB PE=3 SV=1 28 345 1.0E-20
sp|A1KRE1|PYRB_NEIMF Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=pyrB PE=3 SV=1 28 345 2.0E-20
sp|B4RPW7|PYRB_NEIG2 Aspartate carbamoyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pyrB PE=3 SV=1 28 345 2.0E-20
sp|C4LBX2|PYRB_TOLAT Aspartate carbamoyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pyrB PE=3 SV=1 31 345 2.0E-20
sp|Q5F5P0|PYRB_NEIG1 Aspartate carbamoyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pyrB PE=3 SV=1 28 345 4.0E-20
sp|B0TST3|PYRB2_SHEHH Aspartate carbamoyltransferase 2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=pyrB2 PE=3 SV=1 31 345 8.0E-20
sp|P65616|PYRB_NEIMB Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pyrB PE=3 SV=1 28 345 1.0E-19
sp|P65615|PYRB_NEIMA Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pyrB PE=3 SV=1 28 345 1.0E-19
sp|B8GF03|PYRB_METPE Aspartate carbamoyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pyrB PE=3 SV=1 70 349 3.0E-19
sp|A3CW66|PYRB_METMJ Aspartate carbamoyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pyrB PE=3 SV=1 32 345 1.0E-18
sp|Q7MHF1|PYRB_VIBVY Aspartate carbamoyltransferase OS=Vibrio vulnificus (strain YJ016) GN=pyrB PE=3 SV=1 26 345 2.0E-18
sp|Q8DCF6|PYRB_VIBVU Aspartate carbamoyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=pyrB PE=3 SV=1 26 345 2.0E-18
sp|Q7P145|PYRB_CHRVO Aspartate carbamoyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pyrB PE=3 SV=1 28 345 2.0E-18
sp|A1JRD5|PYRB_YERE8 Aspartate carbamoyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pyrB PE=3 SV=1 31 345 3.0E-18
sp|Q87LF8|PYRB_VIBPA Aspartate carbamoyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pyrB PE=3 SV=1 25 345 4.0E-18
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 18 345 4.0E-18
sp|A7MSE0|PYRB_VIBCB Aspartate carbamoyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pyrB PE=3 SV=2 25 345 5.0E-18
sp|Q7MZ16|PYRB_PHOLL Aspartate carbamoyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pyrB PE=3 SV=1 28 345 5.0E-18
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 11 345 7.0E-18
sp|Q0STN4|PYRB_CLOPS Aspartate carbamoyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=pyrB PE=3 SV=1 29 345 1.0E-17
sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 31 345 2.0E-17
sp|Q0TRA8|PYRB_CLOP1 Aspartate carbamoyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pyrB PE=3 SV=1 29 345 3.0E-17
sp|O58451|PYRB_PYRHO Aspartate carbamoyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pyrB PE=3 SV=1 28 345 3.0E-17
sp|Q8D293|PYRB_WIGBR Aspartate carbamoyltransferase OS=Wigglesworthia glossinidia brevipalpis GN=pyrB PE=3 SV=1 31 352 3.0E-17
sp|B0TPF3|PYRB3_SHEHH Aspartate carbamoyltransferase 3 OS=Shewanella halifaxensis (strain HAW-EB4) GN=pyrB3 PE=3 SV=1 31 345 4.0E-17
sp|Q665I6|PYRB_YERPS Aspartate carbamoyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pyrB PE=3 SV=1 31 345 4.0E-17
sp|B2K421|PYRB_YERPB Aspartate carbamoyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pyrB PE=3 SV=1 31 345 4.0E-17
sp|A4THG6|PYRB_YERPP Aspartate carbamoyltransferase OS=Yersinia pestis (strain Pestoides F) GN=pyrB PE=3 SV=1 31 345 4.0E-17
sp|Q1CDY3|PYRB_YERPN Aspartate carbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pyrB PE=3 SV=1 31 345 4.0E-17
sp|A9R1U2|PYRB_YERPG Aspartate carbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pyrB PE=3 SV=1 31 345 4.0E-17
sp|Q8ZB39|PYRB_YERPE Aspartate carbamoyltransferase OS=Yersinia pestis GN=pyrB PE=1 SV=1 31 345 4.0E-17
sp|Q1C1J5|PYRB_YERPA Aspartate carbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pyrB PE=3 SV=1 31 345 4.0E-17
sp|C1D9A7|PYRB_LARHH Aspartate carbamoyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=pyrB PE=3 SV=1 31 345 4.0E-17
sp|B1JKJ8|PYRB_YERPY Aspartate carbamoyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pyrB PE=3 SV=1 31 345 4.0E-17
sp|A7FDV1|PYRB_YERP3 Aspartate carbamoyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pyrB PE=3 SV=1 31 345 4.0E-17
sp|B6YXW4|PYRB_THEON Aspartate carbamoyltransferase OS=Thermococcus onnurineus (strain NA1) GN=pyrB PE=3 SV=1 73 347 5.0E-17
sp|Q8XL59|PYRB_CLOPE Aspartate carbamoyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=pyrB PE=3 SV=1 29 345 5.0E-17
sp|A9KNJ3|PYRB_CLOPH Aspartate carbamoyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=pyrB PE=3 SV=1 31 345 5.0E-17
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 31 345 6.0E-17
sp|Q8TVB2|PYRB_METKA Aspartate carbamoyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pyrB PE=3 SV=1 26 346 7.0E-17
sp|Q8U373|PYRB_PYRFU Aspartate carbamoyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pyrB PE=3 SV=1 28 345 8.0E-17
sp|C0Q7B8|PYRB_SALPC Aspartate carbamoyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=pyrB PE=3 SV=1 31 345 1.0E-16
sp|Q9RVC0|PYRB_DEIRA Aspartate carbamoyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pyrB PE=3 SV=1 29 352 1.0E-16
sp|P0A1Z4|PYRB_SALTY Aspartate carbamoyltransferase catalytic chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pyrB PE=3 SV=2 31 345 1.0E-16
sp|P0A1Z5|PYRB_SALTI Aspartate carbamoyltransferase catalytic chain OS=Salmonella typhi GN=pyrB PE=3 SV=2 31 345 1.0E-16
sp|B4TT83|PYRB_SALSV Aspartate carbamoyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=pyrB PE=3 SV=1 31 345 1.0E-16
sp|B5BKQ9|PYRB_SALPK Aspartate carbamoyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=pyrB PE=3 SV=1 31 345 1.0E-16
sp|A9N659|PYRB_SALPB Aspartate carbamoyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pyrB PE=3 SV=2 31 345 1.0E-16
sp|Q5PJB2|PYRB_SALPA Aspartate carbamoyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pyrB PE=3 SV=1 31 345 1.0E-16
sp|B4T3K6|PYRB_SALNS Aspartate carbamoyltransferase OS=Salmonella newport (strain SL254) GN=pyrB PE=3 SV=1 31 345 1.0E-16
sp|B4TG41|PYRB_SALHS Aspartate carbamoyltransferase OS=Salmonella heidelberg (strain SL476) GN=pyrB PE=3 SV=1 31 345 1.0E-16
sp|B5R9J9|PYRB_SALG2 Aspartate carbamoyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pyrB PE=3 SV=1 31 345 1.0E-16
sp|B5R1I6|PYRB_SALEP Aspartate carbamoyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=pyrB PE=3 SV=1 31 345 1.0E-16
sp|Q57GE1|PYRB_SALCH Aspartate carbamoyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=pyrB PE=3 SV=1 31 345 1.0E-16
sp|B5F446|PYRB_SALA4 Aspartate carbamoyltransferase OS=Salmonella agona (strain SL483) GN=pyrB PE=3 SV=1 31 345 1.0E-16
sp|B5F9P9|PYRB_VIBFM Aspartate carbamoyltransferase OS=Vibrio fischeri (strain MJ11) GN=pyrB PE=3 SV=1 25 345 1.0E-16
sp|A1SZR6|PYRB_PSYIN Aspartate carbamoyltransferase OS=Psychromonas ingrahamii (strain 37) GN=pyrB PE=3 SV=1 31 340 1.0E-16
sp|P77918|PYRB_PYRAB Aspartate carbamoyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pyrB PE=1 SV=1 28 345 1.0E-16
sp|Q5JHM9|PYRB_THEKO Aspartate carbamoyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pyrB PE=3 SV=1 28 333 2.0E-16
sp|A0B8L1|PYRB_METTP Aspartate carbamoyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pyrB PE=3 SV=1 31 325 2.0E-16
sp|P96174|PYRB_VIBS2 Aspartate carbamoyltransferase catalytic chain OS=Vibrio sp. (strain 2693) GN=pyrB PE=3 SV=3 31 345 3.0E-16
sp|Q5E7U5|PYRB_VIBF1 Aspartate carbamoyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pyrB PE=3 SV=1 31 345 3.0E-16
sp|B6EMS5|PYRB_ALISL Aspartate carbamoyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=pyrB PE=3 SV=1 25 345 3.0E-16
sp|O30130|PYRB_ARCFU Aspartate carbamoyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pyrB PE=3 SV=1 31 325 5.0E-16
sp|B0TSQ4|PYRB1_SHEHH Aspartate carbamoyltransferase 1 OS=Shewanella halifaxensis (strain HAW-EB4) GN=pyrB1 PE=3 SV=1 31 345 5.0E-16
sp|C5A2H1|PYRB_THEGJ Aspartate carbamoyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pyrB PE=3 SV=1 73 345 6.0E-16
sp|Q46DA6|PYRB_METBF Aspartate carbamoyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pyrB PE=3 SV=1 27 325 1.0E-15
sp|B5FSF3|PYRB_SALDC Aspartate carbamoyltransferase OS=Salmonella dublin (strain CT_02021853) GN=pyrB PE=3 SV=1 31 345 1.0E-15
sp|B6JKT9|PYRB_HELP2 Aspartate carbamoyltransferase OS=Helicobacter pylori (strain P12) GN=pyrB PE=3 SV=1 29 350 2.0E-15
sp|A4W605|PYRB_ENT38 Aspartate carbamoyltransferase OS=Enterobacter sp. (strain 638) GN=pyrB PE=3 SV=1 31 345 2.0E-15
sp|Q9KP66|PYRB_VIBCH Aspartate carbamoyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pyrB PE=3 SV=2 25 345 3.0E-15
sp|Q6LUX0|PYRB_PHOPR Aspartate carbamoyltransferase OS=Photobacterium profundum GN=pyrB PE=3 SV=1 25 345 3.0E-15
sp|Q2NR35|PYRB_SODGM Aspartate carbamoyltransferase OS=Sodalis glossinidius (strain morsitans) GN=pyrB PE=3 SV=1 31 352 3.0E-15
sp|Q8K9H9|PYRB_BUCAP Aspartate carbamoyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=pyrB PE=3 SV=1 26 352 3.0E-15
sp|A9A2Q5|PYRB_NITMS Aspartate carbamoyltransferase OS=Nitrosopumilus maritimus (strain SCM1) GN=pyrB PE=3 SV=1 26 345 4.0E-15
sp|A5F5C9|PYRB_VIBC3 Aspartate carbamoyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pyrB PE=3 SV=2 25 345 4.0E-15
sp|P19910|PYRB_SERMA Aspartate carbamoyltransferase catalytic chain OS=Serratia marcescens GN=pyrB PE=3 SV=2 31 345 5.0E-15
sp|Q1CUE2|PYRB_HELPH Aspartate carbamoyltransferase OS=Helicobacter pylori (strain HPAG1) GN=pyrB PE=3 SV=1 29 350 6.0E-15
sp|B2UW93|PYRB_CLOBA Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pyrB PE=3 SV=1 29 345 7.0E-15
sp|B2TNG3|PYRB_CLOBB Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pyrB PE=3 SV=1 29 345 1.0E-14
sp|B7IUP9|PYRB_BACC2 Aspartate carbamoyltransferase OS=Bacillus cereus (strain G9842) GN=pyrB PE=3 SV=1 32 345 1.0E-14
sp|Q9PEN0|AOTC_XYLFA N-acetylornithine carbamoyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=argF' PE=3 SV=1 31 345 1.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0016743 carboxyl- or carbamoyltransferase activity Yes
GO:0016597 amino acid binding Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:0003824 catalytic activity No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0043177 organic acid binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043436 oxoacid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6526
MRTPALRLAQRSLASPSHRQIRCFASAYRPRHLLSIGDLTAPELSAIVRNTTSLKLASADNNMPPALKTSLAGKT
VAMMFSKRSTRTRVSTEAAVCMLGGHAMFLGKDDIQLGVNESLYDTSVVISSMTAAMVARVGPHSDVVNLAKHSS
VPVINALSDDFHPLQTIADLATLHQSFPPTTFSPSGLSLQGLKVAWIGDANNVLFDLAAGCVKMGIDVAVAAPKG
YGIPDAMRQIITSPGKGVESPGTLFETTVPEEAVKDADVLVTDTWVSMGQESDKQKRLDAFAGYQVTDELAKRGG
AKEGWKFMHCLPRHAEEVDDQVFYGPRSLVFTEAKNRLWAALAVLEGFVVHKGRV*
Coding >OphauB2|6526
ATGAGGACGCCCGCTCTGCGTCTGGCCCAGAGGTCTCTGGCCAGCCCGTCACACAGGCAGATTCGCTGCTTTGCC
TCTGCATACCGCCCCAGACATCTGCTGTCCATTGGGGACCTGACGGCGCCCGAGCTCAGCGCAATAGTGCGCAAT
ACCACGTCGCTCAAATTGGCCTCGGCCGACAACAACATGCCGCCGGCGCTCAAGACGTCATTGGCGGGCAAGACG
GTGGCCATGATGTTTAGCAAGCGTAGCACGCGCACCCGCGTCTCAACAGAGGCTGCGGTTTGCATGCTGGGAGGC
CATGCCATGTTTCTTGGCAAAGACGACATTCAGCTGGGTGTCAATGAGTCTCTATACGACACGTCGGTTGTCATC
TCGTCCATGACGGCGGCCATGGTGGCTCGTGTCGGGCCGCATTCCGACGTGGTCAATCTTGCCAAGCATTCCAGC
GTGCCAGTCATCAATGCTCTCTCGGATGATTTTCACCCTTTGCAAACCATTGCCGACCTGGCTACCCTTCATCAG
TCCTTTCCCCCGACCACGTTTTCGCCCTCTGGCCTGAGCCTCCAAGGCCTCAAGGTGGCTTGGATTGGCGATGCC
AACAATGTTCTTTTCGACTTGGCTGCCGGCTGCGTCAAGATGGGCATCGACGTTGCCGTTGCAGCTCCCAAGGGC
TACGGCATCCCCGACGCAATGAGGCAAATCATTACGTCGCCAGGCAAAGGCGTTGAGTCGCCCGGCACACTCTTT
GAGACGACTGTGCCAGAAGAAGCCGTCAAGGATGCTGATGTGCTCGTCACAGACACGTGGGTCTCAATGGGACAG
GAAAGCGACAAGCAGAAGCGCCTCGACGCCTTTGCCGGCTACCAAGTCACAGACGAGCTGGCCAAGCGTGGCGGT
GCAAAGGAGGGGTGGAAATTTATGCACTGCTTGCCTCGCCACGCCGAAGAGGTTGATGACCAAGTCTTTTATGGG
CCTCGCTCTCTTGTCTTTACCGAGGCCAAGAACCGGCTGTGGGCAGCTCTTGCTGTTCTTGAGGGGTTTGTTGTG
CACAAGGGCCGCGTATAA
Transcript >OphauB2|6526
ATGAGGACGCCCGCTCTGCGTCTGGCCCAGAGGTCTCTGGCCAGCCCGTCACACAGGCAGATTCGCTGCTTTGCC
TCTGCATACCGCCCCAGACATCTGCTGTCCATTGGGGACCTGACGGCGCCCGAGCTCAGCGCAATAGTGCGCAAT
ACCACGTCGCTCAAATTGGCCTCGGCCGACAACAACATGCCGCCGGCGCTCAAGACGTCATTGGCGGGCAAGACG
GTGGCCATGATGTTTAGCAAGCGTAGCACGCGCACCCGCGTCTCAACAGAGGCTGCGGTTTGCATGCTGGGAGGC
CATGCCATGTTTCTTGGCAAAGACGACATTCAGCTGGGTGTCAATGAGTCTCTATACGACACGTCGGTTGTCATC
TCGTCCATGACGGCGGCCATGGTGGCTCGTGTCGGGCCGCATTCCGACGTGGTCAATCTTGCCAAGCATTCCAGC
GTGCCAGTCATCAATGCTCTCTCGGATGATTTTCACCCTTTGCAAACCATTGCCGACCTGGCTACCCTTCATCAG
TCCTTTCCCCCGACCACGTTTTCGCCCTCTGGCCTGAGCCTCCAAGGCCTCAAGGTGGCTTGGATTGGCGATGCC
AACAATGTTCTTTTCGACTTGGCTGCCGGCTGCGTCAAGATGGGCATCGACGTTGCCGTTGCAGCTCCCAAGGGC
TACGGCATCCCCGACGCAATGAGGCAAATCATTACGTCGCCAGGCAAAGGCGTTGAGTCGCCCGGCACACTCTTT
GAGACGACTGTGCCAGAAGAAGCCGTCAAGGATGCTGATGTGCTCGTCACAGACACGTGGGTCTCAATGGGACAG
GAAAGCGACAAGCAGAAGCGCCTCGACGCCTTTGCCGGCTACCAAGTCACAGACGAGCTGGCCAAGCGTGGCGGT
GCAAAGGAGGGGTGGAAATTTATGCACTGCTTGCCTCGCCACGCCGAAGAGGTTGATGACCAAGTCTTTTATGGG
CCTCGCTCTCTTGTCTTTACCGAGGCCAAGAACCGGCTGTGGGCAGCTCTTGCTGTTCTTGAGGGGTTTGTTGTG
CACAAGGGCCGCGTATAA
Gene >OphauB2|6526
ATGAGGACGCCCGCTCTGCGTCTGGCCCAGAGGTCTCTGGCCAGCCCGTCACACAGGCAGATTCGCTGCTTTGCC
TCTGCATACCGCCCCAGACATCTGCTGTCCATTGGGGACCTGACGGCGCCCGAGCTCAGCGCAATAGTGCGCAAT
ACCACGTCGCTCAAATTGGCCTCGGCCGACAACAACATGCCGCCGGCGCTCAAGACGTCATTGGCGGGCAAGACG
GTGGCCATGATGTTTAGCAAGCGTAGCACGCGCACCCGCGTCTCAACAGAGGCTGCGGTTTGCATGCTGGGAGGC
CATGCCATGTTTCTTGGCAAAGACGACATTCAGCTGGGTGTATGCCGACTTGACTCATTGCCGCCGGCATCAATG
ACTGACAGGGTGCAAATTTCCAGGTCAATGAGTCTCTATACGACACGTCGGTTGTCATCTCGTCCATGACGGCGG
CCATGGTGGCTCGTGTCGGGCCGCATTCCGACGTGGTCAATCTTGCCAAGCATTCCAGCGTGCCAGTCATCAATG
CTCTCTCGGATGATTTTCACCCTTTGCAAACCATTGCCGACCTGGCTACCCTTCATCAGTCCTTTCCCCCGACCA
CGTTTTCGCCCTCTGGCCTGAGCCTCCAAGGCCTCAAGGTGGCTTGGATTGGCGATGCCAACAATGTTCTTTTCG
ACTTGGCTGCCGGCTGCGTCAAGATGGGCATCGACGTTGCCGTTGCAGCTCCCAAGGGCTACGGCATCCCCGACG
CAATGAGGCAAATCATTACGTCGCCAGGCAAAGGCGTTGAGTCGCCCGGCACACTCTTTGAGACGACTGTGCCAG
AAGAAGCCGTCAAGGATGCTGATGTGCTCGTCACAGACACGTGGGTCTCAATGGGACAGGAAAGCGACAAGCAGA
AGCGCCTCGACGCCTTTGCCGGCTACCAAGTCACAGACGAGCTGGCCAAGCGTGGCGGTGCAAAGGAGGGGTGGA
AATTTATGCACTGCTTGCCTCGCCACGCCGAAGAGGTTGATGACCAAGTCTTTTATGGGCCTCGCTCTCTTGTCT
TTACCGAGGCCAAGAACCGGCTGTGGGCAGCTCTTGGTGCGTAATGTTGATTTATCATGGCTTCTTGCTTTGATT
GCTCATGGAGTTGCTGACCCAATTTTCTTGTTATTAGCTGTTCTTGAGGGGTTTGTTGTGCACAAGGGCCGCGTA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail