Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6515
Gene name
LocationContig_6:236341..238412
Strand-
Gene length (bp)2071
Transcript length (bp)2001
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09441 Abp2 ARS binding protein 2 8.8E-79 5 173

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USY4|ABP2_SCHPO ARS-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abp2 PE=1 SV=1 3 157 2.0E-29

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6515
MLATLPDRHVTADNIEEAYVRFIFYCNPAVSPASDTATLREGFRNPPRSGGRTFHPYTVYELVRRFYAKDIKTWT
ELTTTLGVEPPDPSKDESAQKISQYGVRLKKWMNSMHVRAFFEYLMDMPNDYWTKVPSDPNPIACPVRDGVAVED
DMALRALIPHIRPKRGRKRPEPDDGAFSPSKRHGLLPSLVSNPDYRQGLQPWSAHPSSRPTAWTPGDNLATSTAR
WPHSAVTPSSRGSFWDDALESPCSAAPLHAKHARVRRGAKNVSSAWKPGGLDGGAKPRGRPPIPRSSLDDSHAAP
QPWTPIQETRASSASHSLPHVRDQNSPELGHSPQQGYLPPSSHSGPTSVPPDLSQRHSSHDSNRLPRPNISLQVP
ERLGGSVRLATPPTPPTWTRHHERTEPAANCHTRSDCSNYAKTQQHVPPPEQHAPDGWQRYAKEATDAYEQATNV
PSNGCDKPEHIPQYYFEKIDDRTNVDTLVSYFVRSMSDSEWIDHEGNPDEPSTVEESTALVNAMLENMFKTATSP
QAFLINLAALAGSMTLVTARPKCIRMGKKGDANMYKCDWEYRFGHVKCRFTMTQDVPCSMWCKGNRSGDHFDGVS
AASEVDRLQRDAGLEGKGQEESPLSAADWKRKYRALVDEVEKRNRELANLRGSVMKCLGREWMAPS*
Coding >OphauB2|6515
ATGCTCGCCACACTCCCAGATCGCCATGTCACGGCCGACAACATTGAGGAGGCCTATGTGCGCTTCATCTTTTAC
TGCAACCCCGCAGTCTCACCAGCCTCGGACACGGCAACGCTGCGCGAGGGCTTCCGCAATCCGCCTCGCAGCGGA
GGCAGGACCTTTCATCCCTATACCGTCTATGAGCTGGTGCGCAGATTTTATGCCAAGGACATCAAGACGTGGACC
GAGTTGACAACCACTCTTGGTGTTGAGCCGCCAGATCCCTCCAAGGACGAGAGTGCTCAAAAGATATCTCAGTAC
GGCGTCCGCCTCAAGAAATGGATGAATTCGATGCATGTCAGGGCCTTTTTCGAGTATCTCATGGACATGCCCAAT
GACTACTGGACCAAGGTTCCCTCAGATCCTAACCCCATTGCATGTCCTGTCCGCGATGGCGTGGCCGTTGAGGAT
GACATGGCTCTGCGAGCACTCATACCGCACATTCGGCCCAAGAGGGGGAGGAAACGACCGGAGCCCGATGACGGA
GCCTTTTCTCCTTCCAAACGGCATGGCCTCTTGCCGTCTCTGGTGAGCAATCCAGACTACCGACAGGGGCTGCAG
CCATGGTCGGCTCATCCATCTAGCCGGCCGACTGCTTGGACACCAGGCGACAACCTTGCCACTTCCACTGCTCGC
TGGCCTCATTCGGCCGTGACTCCATCAAGTAGGGGCAGTTTCTGGGACGACGCGCTCGAGTCGCCTTGTTCCGCG
GCGCCTTTACATGCCAAGCACGCTCGAGTGAGGCGAGGCGCAAAGAATGTCTCGTCAGCCTGGAAGCCAGGCGGC
CTCGATGGGGGTGCTAAGCCTCGCGGCCGACCTCCTATACCCCGTTCCTCTTTGGATGACTCACATGCTGCCCCT
CAGCCTTGGACGCCTATCCAAGAGACGAGGGCTTCGAGTGCAAGCCATTCCCTCCCCCATGTCCGCGACCAGAAT
AGCCCTGAGCTGGGCCATTCTCCGCAGCAAGGCTACTTGCCCCCAAGCAGCCACTCTGGCCCTACTTCAGTACCG
CCGGACCTTTCACAAAGACACAGCTCCCACGACTCAAATCGGCTTCCCAGGCCCAACATATCGCTGCAGGTACCC
GAGAGACTTGGCGGCTCAGTGCGGCTGGCTACACCCCCCACGCCCCCGACATGGACACGGCACCACGAGCGGACA
GAGCCTGCCGCCAATTGCCACACTAGAAGCGACTGCAGTAACTACGCCAAGACGCAGCAGCATGTTCCACCGCCC
GAGCAGCACGCCCCTGATGGCTGGCAGCGATATGCAAAGGAAGCAACCGACGCCTACGAGCAAGCTACCAATGTG
CCTAGCAATGGCTGCGACAAGCCAGAACACATTCCCCAGTACTATTTTGAAAAGATTGACGACCGCACAAACGTG
GACACGCTCGTTTCCTACTTTGTCCGTTCAATGAGCGACTCGGAATGGATCGACCACGAGGGCAACCCAGACGAG
CCGTCAACGGTGGAGGAGTCGACGGCGCTTGTCAATGCCATGCTGGAAAACATGTTCAAGACGGCAACGTCGCCG
CAGGCCTTTCTCATCAACCTGGCCGCTCTTGCGGGCTCCATGACGCTCGTGACGGCGCGTCCCAAGTGTATCCGC
ATGGGCAAAAAGGGCGATGCCAACATGTACAAGTGCGACTGGGAGTACCGCTTTGGGCATGTCAAGTGCCGCTTC
ACCATGACACAAGACGTGCCGTGCTCCATGTGGTGCAAGGGCAACAGGTCGGGAGACCATTTTGACGGCGTGAGT
GCTGCGTCGGAAGTGGATAGGCTGCAGCGAGATGCTGGCCTCGAGGGCAAGGGGCAAGAAGAGTCGCCTCTCTCG
GCTGCCGATTGGAAGCGAAAATACCGCGCACTGGTGGACGAGGTTGAAAAACGAAACAGGGAACTGGCGAATCTG
CGGGGCAGCGTCATGAAATGTTTAGGGCGGGAGTGGATGGCGCCGTCGTGA
Transcript >OphauB2|6515
ATGCTCGCCACACTCCCAGATCGCCATGTCACGGCCGACAACATTGAGGAGGCCTATGTGCGCTTCATCTTTTAC
TGCAACCCCGCAGTCTCACCAGCCTCGGACACGGCAACGCTGCGCGAGGGCTTCCGCAATCCGCCTCGCAGCGGA
GGCAGGACCTTTCATCCCTATACCGTCTATGAGCTGGTGCGCAGATTTTATGCCAAGGACATCAAGACGTGGACC
GAGTTGACAACCACTCTTGGTGTTGAGCCGCCAGATCCCTCCAAGGACGAGAGTGCTCAAAAGATATCTCAGTAC
GGCGTCCGCCTCAAGAAATGGATGAATTCGATGCATGTCAGGGCCTTTTTCGAGTATCTCATGGACATGCCCAAT
GACTACTGGACCAAGGTTCCCTCAGATCCTAACCCCATTGCATGTCCTGTCCGCGATGGCGTGGCCGTTGAGGAT
GACATGGCTCTGCGAGCACTCATACCGCACATTCGGCCCAAGAGGGGGAGGAAACGACCGGAGCCCGATGACGGA
GCCTTTTCTCCTTCCAAACGGCATGGCCTCTTGCCGTCTCTGGTGAGCAATCCAGACTACCGACAGGGGCTGCAG
CCATGGTCGGCTCATCCATCTAGCCGGCCGACTGCTTGGACACCAGGCGACAACCTTGCCACTTCCACTGCTCGC
TGGCCTCATTCGGCCGTGACTCCATCAAGTAGGGGCAGTTTCTGGGACGACGCGCTCGAGTCGCCTTGTTCCGCG
GCGCCTTTACATGCCAAGCACGCTCGAGTGAGGCGAGGCGCAAAGAATGTCTCGTCAGCCTGGAAGCCAGGCGGC
CTCGATGGGGGTGCTAAGCCTCGCGGCCGACCTCCTATACCCCGTTCCTCTTTGGATGACTCACATGCTGCCCCT
CAGCCTTGGACGCCTATCCAAGAGACGAGGGCTTCGAGTGCAAGCCATTCCCTCCCCCATGTCCGCGACCAGAAT
AGCCCTGAGCTGGGCCATTCTCCGCAGCAAGGCTACTTGCCCCCAAGCAGCCACTCTGGCCCTACTTCAGTACCG
CCGGACCTTTCACAAAGACACAGCTCCCACGACTCAAATCGGCTTCCCAGGCCCAACATATCGCTGCAGGTACCC
GAGAGACTTGGCGGCTCAGTGCGGCTGGCTACACCCCCCACGCCCCCGACATGGACACGGCACCACGAGCGGACA
GAGCCTGCCGCCAATTGCCACACTAGAAGCGACTGCAGTAACTACGCCAAGACGCAGCAGCATGTTCCACCGCCC
GAGCAGCACGCCCCTGATGGCTGGCAGCGATATGCAAAGGAAGCAACCGACGCCTACGAGCAAGCTACCAATGTG
CCTAGCAATGGCTGCGACAAGCCAGAACACATTCCCCAGTACTATTTTGAAAAGATTGACGACCGCACAAACGTG
GACACGCTCGTTTCCTACTTTGTCCGTTCAATGAGCGACTCGGAATGGATCGACCACGAGGGCAACCCAGACGAG
CCGTCAACGGTGGAGGAGTCGACGGCGCTTGTCAATGCCATGCTGGAAAACATGTTCAAGACGGCAACGTCGCCG
CAGGCCTTTCTCATCAACCTGGCCGCTCTTGCGGGCTCCATGACGCTCGTGACGGCGCGTCCCAAGTGTATCCGC
ATGGGCAAAAAGGGCGATGCCAACATGTACAAGTGCGACTGGGAGTACCGCTTTGGGCATGTCAAGTGCCGCTTC
ACCATGACACAAGACGTGCCGTGCTCCATGTGGTGCAAGGGCAACAGGTCGGGAGACCATTTTGACGGCGTGAGT
GCTGCGTCGGAAGTGGATAGGCTGCAGCGAGATGCTGGCCTCGAGGGCAAGGGGCAAGAAGAGTCGCCTCTCTCG
GCTGCCGATTGGAAGCGAAAATACCGCGCACTGGTGGACGAGGTTGAAAAACGAAACAGGGAACTGGCGAATCTG
CGGGGCAGCGTCATGAAATGTTTAGGGCGGGAGTGGATGGCGCCGTCGTGA
Gene >OphauB2|6515
ATGCTCGCCACACTCCCAGATCGCCATGTCACGGCCGACAACATTGAGGAGGCCTATGTGCGCTTCATCTTTTAC
TGCAACCCCGCAGTCTCACCAGCCTCGGACACGGCAACGCTGCGCGAGGGCTTCCGCAATCCGCCTCGCAGCGGA
GGCAGGACCTTTCATCCCTATACCGTCTATGAGCTGGTGCGCAGATTTTATGCCAAGGACATCAAGACGTGGACC
GAGTTGACAACCACTCTTGGTGTTGAGCCGCCAGATCCCTCCAAGGACGAGAGTGCTCAAAAGATATCTCAGTAC
GGCGTCCGCCTCAAGGTGAGTCTTGAGGGGAAAGGCCTTTGTATCATTTTGGGCTCCGTCACTGCTGACACCCGG
CTGGCTCTAGAAATGGATGAATTCGATGCATGTCAGGGCCTTTTTCGAGTATCTCATGGACATGCCCAATGACTA
CTGGACCAAGGTTCCCTCAGATCCTAACCCCATTGCATGTCCTGTCCGCGATGGCGTGGCCGTTGAGGATGACAT
GGCTCTGCGAGCACTCATACCGCACATTCGGCCCAAGAGGGGGAGGAAACGACCGGAGCCCGATGACGGAGCCTT
TTCTCCTTCCAAACGGCATGGCCTCTTGCCGTCTCTGGTGAGCAATCCAGACTACCGACAGGGGCTGCAGCCATG
GTCGGCTCATCCATCTAGCCGGCCGACTGCTTGGACACCAGGCGACAACCTTGCCACTTCCACTGCTCGCTGGCC
TCATTCGGCCGTGACTCCATCAAGTAGGGGCAGTTTCTGGGACGACGCGCTCGAGTCGCCTTGTTCCGCGGCGCC
TTTACATGCCAAGCACGCTCGAGTGAGGCGAGGCGCAAAGAATGTCTCGTCAGCCTGGAAGCCAGGCGGCCTCGA
TGGGGGTGCTAAGCCTCGCGGCCGACCTCCTATACCCCGTTCCTCTTTGGATGACTCACATGCTGCCCCTCAGCC
TTGGACGCCTATCCAAGAGACGAGGGCTTCGAGTGCAAGCCATTCCCTCCCCCATGTCCGCGACCAGAATAGCCC
TGAGCTGGGCCATTCTCCGCAGCAAGGCTACTTGCCCCCAAGCAGCCACTCTGGCCCTACTTCAGTACCGCCGGA
CCTTTCACAAAGACACAGCTCCCACGACTCAAATCGGCTTCCCAGGCCCAACATATCGCTGCAGGTACCCGAGAG
ACTTGGCGGCTCAGTGCGGCTGGCTACACCCCCCACGCCCCCGACATGGACACGGCACCACGAGCGGACAGAGCC
TGCCGCCAATTGCCACACTAGAAGCGACTGCAGTAACTACGCCAAGACGCAGCAGCATGTTCCACCGCCCGAGCA
GCACGCCCCTGATGGCTGGCAGCGATATGCAAAGGAAGCAACCGACGCCTACGAGCAAGCTACCAATGTGCCTAG
CAATGGCTGCGACAAGCCAGAACACATTCCCCAGTACTATTTTGAAAAGATTGACGACCGCACAAACGTGGACAC
GCTCGTTTCCTACTTTGTCCGTTCAATGAGCGACTCGGAATGGATCGACCACGAGGGCAACCCAGACGAGCCGTC
AACGGTGGAGGAGTCGACGGCGCTTGTCAATGCCATGCTGGAAAACATGTTCAAGACGGCAACGTCGCCGCAGGC
CTTTCTCATCAACCTGGCCGCTCTTGCGGGCTCCATGACGCTCGTGACGGCGCGTCCCAAGTGTATCCGCATGGG
CAAAAAGGGCGATGCCAACATGTACAAGTGCGACTGGGAGTACCGCTTTGGGCATGTCAAGTGCCGCTTCACCAT
GACACAAGACGTGCCGTGCTCCATGTGGTGCAAGGGCAACAGGTCGGGAGACCATTTTGACGGCGTGAGTGCTGC
GTCGGAAGTGGATAGGCTGCAGCGAGATGCTGGCCTCGAGGGCAAGGGGCAAGAAGAGTCGCCTCTCTCGGCTGC
CGATTGGAAGCGAAAATACCGCGCACTGGTGGACGAGGTTGAAAAACGAAACAGGGAACTGGCGAATCTGCGGGG
CAGCGTCATGAAATGTTTAGGGCGGGAGTGGATGGCGCCGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail