Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6510
Gene name
LocationContig_6:219651..220677
Strand+
Gene length (bp)1026
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01351 RNase_HII Ribonuclease HII 1.4E-48 60 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P5X8|RNH2A_NEUCR Ribonuclease H2 subunit A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnh-201 PE=3 SV=1 13 341 3.0E-123
sp|Q10236|RNH2A_SCHPO Ribonuclease H2 subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh201 PE=3 SV=1 2 304 2.0E-80
sp|O75792|RNH2A_HUMAN Ribonuclease H2 subunit A OS=Homo sapiens GN=RNASEH2A PE=1 SV=2 57 317 2.0E-55
sp|Q2TBT5|RNH2A_BOVIN Ribonuclease H2 subunit A OS=Bos taurus GN=RNASEH2A PE=1 SV=1 37 296 2.0E-53
sp|P53942|RNH2A_YEAST Ribonuclease H2 subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH201 PE=1 SV=1 17 299 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P5X8|RNH2A_NEUCR Ribonuclease H2 subunit A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnh-201 PE=3 SV=1 13 341 3.0E-123
sp|Q10236|RNH2A_SCHPO Ribonuclease H2 subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh201 PE=3 SV=1 2 304 2.0E-80
sp|O75792|RNH2A_HUMAN Ribonuclease H2 subunit A OS=Homo sapiens GN=RNASEH2A PE=1 SV=2 57 317 2.0E-55
sp|Q2TBT5|RNH2A_BOVIN Ribonuclease H2 subunit A OS=Bos taurus GN=RNASEH2A PE=1 SV=1 37 296 2.0E-53
sp|P53942|RNH2A_YEAST Ribonuclease H2 subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH201 PE=1 SV=1 17 299 2.0E-52
sp|Q5U209|RNH2A_RAT Ribonuclease H2 subunit A OS=Rattus norvegicus GN=Rnaseh2a PE=2 SV=1 57 316 5.0E-52
sp|Q9CWY8|RNH2A_MOUSE Ribonuclease H2 subunit A OS=Mus musculus GN=Rnaseh2a PE=1 SV=2 57 322 2.0E-51
sp|Q9VPP5|RNH2A_DROME Ribonuclease H2 subunit A OS=Drosophila melanogaster GN=CG13690 PE=2 SV=1 29 324 4.0E-51
sp|Q9SEZ6|RNH2A_ARATH Ribonuclease H2 subunit A OS=Arabidopsis thaliana GN=At2g25100 PE=2 SV=2 57 306 3.0E-49
sp|Q9U6P6|RNH2A_CAEEL Ribonuclease H2 subunit A OS=Caenorhabditis elegans GN=rnh-2 PE=2 SV=1 50 332 1.0E-48
sp|Q54D13|RNH2A_DICDI Ribonuclease H2 subunit A OS=Dictyostelium discoideum GN=rnaseh2A PE=3 SV=1 57 304 2.0E-48
sp|A4FWE5|RNH2_METM5 Ribonuclease HII OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rnhB PE=3 SV=1 50 299 2.0E-19
sp|A9A9T9|RNH2_METM6 Ribonuclease HII OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rnhB PE=3 SV=1 60 299 2.0E-19
sp|P57673|RNH2_THEAC Ribonuclease HII OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rnhB PE=3 SV=1 52 297 3.0E-19
sp|O59351|RNH2_PYRHO Ribonuclease HII OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rnhB PE=1 SV=1 61 298 8.0E-19
sp|A6VGW0|RNH2_METM7 Ribonuclease HII OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rnhB PE=3 SV=1 60 299 4.0E-18
sp|Q9V1A9|RNH2_PYRAB Ribonuclease HII OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rnhB PE=3 SV=1 61 294 6.0E-18
sp|A2BL34|RNH2_HYPBU Ribonuclease HII OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rnhB PE=3 SV=1 59 287 1.0E-17
sp|Q9YET5|RNH2_AERPE Ribonuclease HII OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rnhB PE=3 SV=2 58 287 2.0E-17
sp|Q6LXH7|RNH2_METMP Ribonuclease HII OS=Methanococcus maripaludis (strain S2 / LL) GN=rnhB PE=3 SV=1 60 299 3.0E-17
sp|Q97CG6|RNH2_THEVO Ribonuclease HII OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rnhB PE=3 SV=2 61 290 7.0E-17
sp|Q8U036|RNH2_PYRFU Ribonuclease HII OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rnhB PE=3 SV=1 61 289 1.0E-16
sp|O74035|RNH2_THEKO Ribonuclease HII OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rnhB PE=1 SV=1 61 290 1.0E-16
sp|A1RYM0|RNH2_THEPD Ribonuclease HII OS=Thermofilum pendens (strain Hrk 5) GN=rnhB PE=3 SV=1 61 283 3.0E-16
sp|B1YB67|RNH2_PYRNV Ribonuclease HII OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rnhB PE=3 SV=1 61 285 4.0E-16
sp|Q74MH3|RNH2_NANEQ Ribonuclease HII OS=Nanoarchaeum equitans (strain Kin4-M) GN=rnhB PE=3 SV=1 61 281 4.0E-16
sp|Q57599|RNH2_METJA Ribonuclease HII OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rnhB PE=1 SV=1 60 292 7.0E-16
sp|Q97W56|RNH2_SULSO Ribonuclease HII OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rnhB PE=3 SV=1 60 285 9.0E-16
sp|Q2NEI6|RNH2_METST Ribonuclease HII OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rnhB PE=3 SV=1 60 287 1.0E-15
sp|Q974Z3|RNH2_SULTO Ribonuclease HII OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rnhB PE=3 SV=1 58 287 1.0E-15
sp|Q8ZXL6|RNH2_PYRAE Ribonuclease HII OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rnhB PE=3 SV=1 61 283 5.0E-15
sp|Q4JA60|RNH2_SULAC Ribonuclease HII OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rnhB PE=3 SV=1 60 287 8.0E-15
sp|A1RU36|RNH2_PYRIL Ribonuclease HII OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rnhB PE=3 SV=1 61 285 3.0E-14
sp|O27102|RNH2_METTH Ribonuclease HII OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rnhB PE=3 SV=1 59 284 7.0E-14
sp|Q12YN9|RNH2_METBU Ribonuclease HII OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rnhB PE=3 SV=1 60 289 2.0E-13
sp|A2STJ6|RNH2_METLZ Ribonuclease HII OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rnhB PE=3 SV=1 61 289 7.0E-13
sp|Q0W5R8|RNH2_METAR Ribonuclease HII OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rnhB PE=3 SV=1 60 284 2.0E-12
sp|A8MAH5|RNH2_CALMQ Ribonuclease HII OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rnhB PE=3 SV=1 61 291 5.0E-12
sp|O29634|RNH2_ARCFU Ribonuclease HII OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rnhB PE=1 SV=1 61 293 2.0E-11
sp|Q8TPF4|RNH2_METAC Ribonuclease HII OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rnhB PE=3 SV=1 61 296 2.0E-11
sp|A4WHQ7|RNH2_PYRAR Ribonuclease HII OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rnhB PE=3 SV=1 61 289 2.0E-11
sp|Q2FP80|RNH2_METHJ Ribonuclease HII OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rnhB PE=3 SV=1 61 299 3.0E-11
sp|Q6KZK4|RNH2_PICTO Ribonuclease HII OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rnhB PE=3 SV=1 58 289 7.0E-11
sp|A7I9P7|RNH2_METB6 Ribonuclease HII OS=Methanoregula boonei (strain 6A8) GN=rnhB PE=3 SV=1 61 291 1.0E-10
sp|A5ULV6|RNH2_METS3 Ribonuclease HII OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rnhB PE=3 SV=1 60 287 1.0E-10
sp|Q8TYV5|RNH2_METKA Ribonuclease HII OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rnhB PE=3 SV=1 60 292 2.0E-10
sp|Q1GUJ1|RNH2_SPHAL Ribonuclease HII OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rnhB PE=3 SV=1 60 225 2.0E-10
sp|Q1LNE4|RNH2_CUPMC Ribonuclease HII OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rnhB PE=3 SV=1 61 290 1.0E-09
sp|Q9HNR3|RNH2_HALSA Ribonuclease HII OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rnhB PE=3 SV=1 60 288 3.0E-09
sp|B0R6T4|RNH2_HALS3 Ribonuclease HII OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rnhB PE=3 SV=1 60 288 3.0E-09
sp|B7GGD5|RNH2_ANOFW Ribonuclease HII OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rnhB PE=3 SV=1 61 231 1.0E-08
sp|Q7VA11|RNH2_PROMA Ribonuclease HII OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rnhB PE=3 SV=1 59 244 1.0E-08
sp|C4K435|RNH2_HAMD5 Ribonuclease HII OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rnhB PE=3 SV=1 61 231 4.0E-08
sp|Q0KA30|RNH2_CUPNH Ribonuclease HII OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rnhB PE=3 SV=1 61 288 4.0E-08
sp|Q2YB96|RNH2_NITMU Ribonuclease HII OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rnhB PE=3 SV=1 57 294 1.0E-07
sp|Q470F1|RNH2_CUPPJ Ribonuclease HII OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rnhB PE=3 SV=1 61 288 1.0E-07
sp|Q5PBG2|RNH2_ANAMM Ribonuclease HII OS=Anaplasma marginale (strain St. Maries) GN=rnhB PE=3 SV=2 60 311 3.0E-07
sp|Q8XZH7|RNH2_RALSO Ribonuclease HII OS=Ralstonia solanacearum (strain GMI1000) GN=rnhB PE=3 SV=1 61 232 5.0E-07
sp|A5G7Z2|RNH2_GEOUR Ribonuclease HII OS=Geobacter uraniireducens (strain Rf4) GN=rnhB PE=3 SV=1 58 289 1.0E-06
sp|Q3IRF6|RNH2_NATPD Ribonuclease HII OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rnhB PE=3 SV=1 60 292 1.0E-06
sp|Q2G794|RNH2_NOVAD Ribonuclease HII OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rnhB PE=3 SV=1 60 225 2.0E-06
sp|Q5UXT4|RNH2_HALMA Ribonuclease HII OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rnhB PE=3 SV=1 60 288 2.0E-06
sp|Q4JV11|RNH2_CORJK Ribonuclease HII OS=Corynebacterium jeikeium (strain K411) GN=rnhB PE=3 SV=1 51 231 3.0E-06
sp|B4SAK8|RNH2_PELPB Ribonuclease HII OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rnhB PE=3 SV=1 61 270 4.0E-06
sp|Q6MDG7|RNH2_PARUW Ribonuclease HII OS=Protochlamydia amoebophila (strain UWE25) GN=rnhB PE=3 SV=1 61 289 5.0E-06
sp|A5GIN4|RNH2_SYNPW Ribonuclease HII OS=Synechococcus sp. (strain WH7803) GN=rnhB PE=3 SV=1 60 225 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2091
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7852
Ophiocordyceps australis map64 (Brazil) OphauB2|6510 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06603
Ophiocordyceps camponoti-rufipedis Ophun1|7375
Ophiocordyceps kimflemingae Ophio5|5806
Ophiocordyceps subramaniannii Hirsu2|2458

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6510
MAAEAVAPDSPPESIHFIPPSIHPDAIVNGSSYLHLSPIPPALLTPSDPNDTSSLPPCAIGIDEAGRGPVLGPMV
YGAFFLPIAQSDTLLRHANHRFDDSKILSPAVRASLVRLLCDPSSALHASCGWAVSSLSARDIAAGMLRSVAPYN
LNSQAFDATVDLIRAIYAQGINVEHIFVDTVGQPAAYQARLQRVFPTARITVAKKADSLYPCVSAASVCAKVTRD
VALDVLYRSRIPPLEQHVSDEPAWGSGYPSDARCVSWLKQNMHPVFGWGPECRFSWSTARDMLEEKKDAIKVDWP
PDNDDDDSVTRMTDFFIPATKTQETNELTTWFGTCAGLEAF*
Coding >OphauB2|6510
ATGGCCGCCGAAGCAGTCGCCCCAGACTCGCCGCCCGAGTCAATACATTTTATTCCTCCGTCCATTCATCCTGAT
GCCATAGTCAACGGCTCTTCCTACTTGCACCTCTCTCCCATTCCCCCCGCCCTTCTCACGCCCTCGGATCCCAAC
GACACCTCTTCCCTCCCCCCCTGCGCCATTGGCATCGACGAAGCCGGCCGCGGCCCCGTGCTCGGCCCCATGGTC
TATGGCGCCTTTTTCCTCCCCATTGCCCAATCCGACACTCTGCTCCGCCACGCCAACCACCGCTTCGACGACTCC
AAGATTCTCTCTCCCGCCGTTCGCGCCTCGCTCGTCCGCCTGCTCTGCGACCCGTCCTCGGCCCTGCACGCCTCG
TGTGGCTGGGCTGTCTCGTCCCTCTCGGCCCGCGACATTGCCGCCGGCATGCTGCGCTCTGTTGCGCCCTACAAT
CTCAACTCGCAGGCCTTTGATGCCACTGTTGACCTCATCCGCGCCATCTACGCCCAGGGAATCAATGTCGAGCAC
ATCTTTGTCGACACAGTTGGCCAGCCCGCTGCATATCAGGCCCGCCTCCAGCGAGTCTTTCCCACCGCCCGCATC
ACCGTTGCCAAGAAAGCAGACAGCCTCTATCCTTGCGTTAGCGCCGCCTCGGTTTGCGCAAAGGTGACTCGTGAC
GTTGCCCTCGATGTGCTCTATCGCTCTCGCATCCCCCCTTTAGAGCAACATGTCTCTGACGAGCCGGCTTGGGGC
TCAGGCTACCCCTCAGATGCCCGCTGTGTCTCATGGCTCAAGCAAAATATGCACCCCGTCTTTGGATGGGGCCCC
GAGTGTCGCTTCAGCTGGTCCACTGCTCGTGACATGCTCGAGGAGAAAAAGGACGCCATCAAAGTCGACTGGCCG
CCCGATAATGACGACGACGACTCAGTAACTAGAATGACAGACTTTTTCATCCCGGCTACCAAGACACAAGAGACT
AATGAGCTGACCACCTGGTTCGGCACTTGTGCTGGACTCGAGGCCTTTTAG
Transcript >OphauB2|6510
ATGGCCGCCGAAGCAGTCGCCCCAGACTCGCCGCCCGAGTCAATACATTTTATTCCTCCGTCCATTCATCCTGAT
GCCATAGTCAACGGCTCTTCCTACTTGCACCTCTCTCCCATTCCCCCCGCCCTTCTCACGCCCTCGGATCCCAAC
GACACCTCTTCCCTCCCCCCCTGCGCCATTGGCATCGACGAAGCCGGCCGCGGCCCCGTGCTCGGCCCCATGGTC
TATGGCGCCTTTTTCCTCCCCATTGCCCAATCCGACACTCTGCTCCGCCACGCCAACCACCGCTTCGACGACTCC
AAGATTCTCTCTCCCGCCGTTCGCGCCTCGCTCGTCCGCCTGCTCTGCGACCCGTCCTCGGCCCTGCACGCCTCG
TGTGGCTGGGCTGTCTCGTCCCTCTCGGCCCGCGACATTGCCGCCGGCATGCTGCGCTCTGTTGCGCCCTACAAT
CTCAACTCGCAGGCCTTTGATGCCACTGTTGACCTCATCCGCGCCATCTACGCCCAGGGAATCAATGTCGAGCAC
ATCTTTGTCGACACAGTTGGCCAGCCCGCTGCATATCAGGCCCGCCTCCAGCGAGTCTTTCCCACCGCCCGCATC
ACCGTTGCCAAGAAAGCAGACAGCCTCTATCCTTGCGTTAGCGCCGCCTCGGTTTGCGCAAAGGTGACTCGTGAC
GTTGCCCTCGATGTGCTCTATCGCTCTCGCATCCCCCCTTTAGAGCAACATGTCTCTGACGAGCCGGCTTGGGGC
TCAGGCTACCCCTCAGATGCCCGCTGTGTCTCATGGCTCAAGCAAAATATGCACCCCGTCTTTGGATGGGGCCCC
GAGTGTCGCTTCAGCTGGTCCACTGCTCGTGACATGCTCGAGGAGAAAAAGGACGCCATCAAAGTCGACTGGCCG
CCCGATAATGACGACGACGACTCAGTAACTAGAATGACAGACTTTTTCATCCCGGCTACCAAGACACAAGAGACT
AATGAGCTGACCACCTGGTTCGGCACTTGTGCTGGACTCGAGGCCTTTTAG
Gene >OphauB2|6510
ATGGCCGCCGAAGCAGTCGCCCCAGACTCGCCGCCCGAGTCAATACATTTTATTCCTCCGTCCATTCATCCTGAT
GCCATAGTCAACGGCTCTTCCTACTTGCACCTCTCTCCCATTCCCCCCGCCCTTCTCACGCCCTCGGATCCCAAC
GACACCTCTTCCCTCCCCCCCTGCGCCATTGGCATCGACGAAGCCGGCCGCGGCCCCGTGCTCGGCCCCATGGTC
TATGGCGCCTTTTTCCTCCCCATTGCCCAATCCGACACTCTGCTCCGCCACGCCAACCACCGCTTCGACGACTCC
AAGATTCTCTCTCCCGCCGTTCGCGCCTCGCTCGTCCGCCTGCTCTGCGACCCGTCCTCGGCCCTGCACGCCTCG
TGTGGCTGGGCTGTCTCGTCCCTCTCGGCCCGCGACATTGCCGCCGGCATGCTGCGCTCTGTTGCGCCCTACAAT
CTCAACTCGCAGGCCTTTGATGCCACTGTTGACCTCATCCGCGCCATCTACGCCCAGGGAATCAATGTCGAGCAC
ATCTTTGTCGACACAGTTGGCCAGCCCGCTGCATATCAGGCCCGCCTCCAGCGAGTCTTTCCCACCGCCCGCATC
ACCGTTGCCAAGAAAGCAGACAGCCTCTATCCTTGCGTTAGCGCCGCCTCGGTTTGCGCAAAGGTGACTCGTGAC
GTTGCCCTCGATGTGCTCTATCGCTCTCGCATCCCCCCTTTAGAGCAACATGTCTCTGACGAGCCGGCTTGGGGC
TCAGGCTACCCCTCAGATGCCCGCTGTGTCTCATGGCTCAAGCAAAATATGCACCCCGTCTTTGGATGGGGCCCC
GAGTGTCGCTTCAGCTGGTCCACTGCTCGTGACATGCTCGAGGAGAAAAAGGACGCCATCAAAGTCGACTGGCCG
CCCGATAATGACGACGACGACTCAGTAACTAGAATGACAGACTTTTTCATCCCGGCTACCAAGACACAAGAGACT
AATGAGCTGACCACCTGGTTCGGCACTTGTGCTGGACTCGAGGCCTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail