Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6500
Gene name
LocationContig_6:190213..191507
Strand-
Gene length (bp)1294
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 205 341 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 3 25 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6500
MKGLLLAGLVYSLLIGLGAAALPSIHDCKRDHRCLADLLHFEGSLEVLQTQCQVGVYKEGTLTASISTINFRRLH
PRCGRVVGHRYQFSAAEFRPVCNCIEDASLPRHCDSISCYGELLLMADSSAHTLRQRCLSRELEGSSPVTVSLSH
FSSQPQCGSSAPGDMVRFSPEEYHPVCQCIVADEASSHIWPASEEAGSVDNVGLIYIDVFLHVVVKSLKSLRAEK
FKQRGKTEDEFNYLLTPIMHKGIKFVIKSMDLTVDAFWASGRDNKIMRQTLHKGDNRDLNFYMVDELSADSKTIE
PINSNTKVYCSPPPNSAAWREEQIGEPVLDGCIISVGMSPGNVTAAMGNAEWKTPLMICAISTAILHTIDMCQSQ
ERLPVL*
Coding >OphauB2|6500
ATGAAGGGGCTCCTCCTTGCAGGCCTCGTATACAGTCTTCTTATAGGCCTTGGGGCCGCAGCTCTTCCCTCTATT
CACGACTGTAAACGCGACCACCGATGTCTTGCCGACCTACTACACTTTGAAGGTTCGCTCGAGGTACTTCAAACC
CAATGTCAGGTGGGCGTCTATAAGGAAGGCACCCTCACTGCAAGCATCAGCACAATCAACTTTCGTCGTCTGCAC
CCACGATGCGGCCGCGTTGTGGGCCACAGGTATCAATTCTCCGCCGCCGAGTTTCGCCCCGTGTGTAACTGCATC
GAAGACGCTTCGCTCCCGAGGCACTGCGACAGCATCTCGTGCTATGGGGAGCTTCTGCTAATGGCAGATTCGTCG
GCTCATACTCTGCGCCAGCGGTGCCTCTCTCGCGAGCTTGAGGGCTCAAGCCCCGTGACCGTCTCGCTTTCCCAC
TTCTCCTCGCAACCTCAATGCGGCAGCAGCGCCCCTGGTGACATGGTCCGATTCTCGCCAGAGGAGTATCATCCT
GTCTGCCAATGCATTGTTGCTGATGAAGCATCATCCCATATTTGGCCCGCTAGTGAAGAGGCTGGTAGCGTTGAT
AACGTGGGGTTAATCTACATCGATGTATTTCTGCATGTTGTCGTAAAATCCCTTAAAAGCCTGCGCGCTGAAAAG
TTTAAGCAGCGAGGTAAGACGGAGGACGAATTTAACTACCTTTTAACGCCCATTATGCACAAAGGCATAAAATTC
GTCATCAAATCCATGGACCTCACCGTGGATGCTTTCTGGGCATCTGGCCGAGACAATAAGATTATGCGACAGACC
CTGCATAAAGGGGACAATCGAGATCTTAATTTTTACATGGTCGATGAGCTCTCGGCTGATAGCAAGACCATTGAA
CCTATCAACAGCAACACCAAGGTTTATTGCAGTCCTCCTCCCAACTCTGCCGCCTGGAGGGAAGAACAGATTGGC
GAGCCTGTTCTGGACGGCTGCATCATCTCGGTCGGCATGAGTCCAGGCAATGTTACCGCCGCCATGGGCAATGCA
GAGTGGAAAACACCTTTGATGATATGCGCAATATCCACGGCAATCTTGCACACTATAGATATGTGCCAATCTCAA
GAGCGGCTACCAGTCCTCTAA
Transcript >OphauB2|6500
ATGAAGGGGCTCCTCCTTGCAGGCCTCGTATACAGTCTTCTTATAGGCCTTGGGGCCGCAGCTCTTCCCTCTATT
CACGACTGTAAACGCGACCACCGATGTCTTGCCGACCTACTACACTTTGAAGGTTCGCTCGAGGTACTTCAAACC
CAATGTCAGGTGGGCGTCTATAAGGAAGGCACCCTCACTGCAAGCATCAGCACAATCAACTTTCGTCGTCTGCAC
CCACGATGCGGCCGCGTTGTGGGCCACAGGTATCAATTCTCCGCCGCCGAGTTTCGCCCCGTGTGTAACTGCATC
GAAGACGCTTCGCTCCCGAGGCACTGCGACAGCATCTCGTGCTATGGGGAGCTTCTGCTAATGGCAGATTCGTCG
GCTCATACTCTGCGCCAGCGGTGCCTCTCTCGCGAGCTTGAGGGCTCAAGCCCCGTGACCGTCTCGCTTTCCCAC
TTCTCCTCGCAACCTCAATGCGGCAGCAGCGCCCCTGGTGACATGGTCCGATTCTCGCCAGAGGAGTATCATCCT
GTCTGCCAATGCATTGTTGCTGATGAAGCATCATCCCATATTTGGCCCGCTAGTGAAGAGGCTGGTAGCGTTGAT
AACGTGGGGTTAATCTACATCGATGTATTTCTGCATGTTGTCGTAAAATCCCTTAAAAGCCTGCGCGCTGAAAAG
TTTAAGCAGCGAGGTAAGACGGAGGACGAATTTAACTACCTTTTAACGCCCATTATGCACAAAGGCATAAAATTC
GTCATCAAATCCATGGACCTCACCGTGGATGCTTTCTGGGCATCTGGCCGAGACAATAAGATTATGCGACAGACC
CTGCATAAAGGGGACAATCGAGATCTTAATTTTTACATGGTCGATGAGCTCTCGGCTGATAGCAAGACCATTGAA
CCTATCAACAGCAACACCAAGGTTTATTGCAGTCCTCCTCCCAACTCTGCCGCCTGGAGGGAAGAACAGATTGGC
GAGCCTGTTCTGGACGGCTGCATCATCTCGGTCGGCATGAGTCCAGGCAATGTTACCGCCGCCATGGGCAATGCA
GAGTGGAAAACACCTTTGATGATATGCGCAATATCCACGGCAATCTTGCACACTATAGATATGTGCCAATCTCAA
GAGCGGCTACCAGTCCTCTAA
Gene >OphauB2|6500
ATGAAGGGGCTCCTCCTTGCAGGCCTCGTATACAGTCTTCTTATAGGCCTTGGGGCCGCAGCTCTTCCCTCTATT
CACGACTGTAAACGCGACCACCGATGTCTTGCCGACCTACTACACTTTGAAGGTTCGCTCGAGGTACTTCAAACC
CAATGTCAGGTGGGCGTCTATAAGGAAGGCACCCTCACTGCAAGCATCAGCACAATCAACTTTCGTCGTCTGCAC
CCACGATGCGGCCGCGTTGTGGGCCACAGGTATCAATTCTCCGCCGCCGAGTTTCGCCCCGTGTGTAACTGCATC
GAAGACGCTTCGCTCCCGAGGCACTGCGACAGCATCTCGTGCTATGGGGAGCTTCTGCTAATGGCAGATTCGTCG
GCTCATACTCTGCGCCAGCGGTGCCTCTCTCGCGAGCTTGAGGGCTCAAGCCCCGTGACCGTCTCGCTTTCCCAC
TTCTCCTCGCAACCTCAATGCGGCAGCAGCGCCCCTGGTGACATGGTCCGATTCTCGCCAGAGGAGTATCATCCT
GTCTGCCAATGCATTGTTGCTGATGAAGCATCATCCCATATTTGGCCCGCTAGTGAAGAGGCTGGTAGCGTTGAT
AACGTGGGGTTAATCTACATCGATGTATTTCTGCATGTTGTCGTAAAATCCCTTAAAAGCCTGCGCGCTGAAAAG
GTGAGTTGTCTCGAAGTGGCGTCTTGATTTACGTTGCTCATTTGTCCATAGTTTAAGCAGCGAGGTAAGACGGAG
GACGAATTTAACTACCTTTTAACGCCCATTATGCACAAAGGCATAAAATTCGTCATCAAATCCATGGACCTCACC
GTGGATGCTTTCTGGGCATCTGGCCGAGACAATAAGATTATGCGACAGACCCTGCATAAAGGGGACAATCGAGAT
CTTAATTTTTACATGGTCGATGAGCTCTCGGCTGATAGCAAGACCATTGAACCTATCAACAGCAACACCAAGGTT
TATTGCAGTCCTCCTCCCAACTCTGCCGCCTGGAGGGAAGAACAGATTGGCGAGCCTGTTCTGGACGGCTGCATC
ATCTCGGTCGGCATGAGTCCAGGCAATGTTACCGCCGCCATGGGTATTTGGACCGGCTTGTGCCGACCTGCAGAT
AGGTGTGCCATGCGATTGACAGAGAAGGCAAAAAAAATCTTGACAAGGCTAACTTTGGCAAACAGGCAATGCAGA
GTGGAAAACACCTTTGATGATATGCGCAATATCCACGGCAATCTTGCACACTATAGATATGTGCCAATCTCAAGA
GCGGCTACCAGTCCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail