Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|65
Gene name
LocationContig_1:157739..159272
Strand-
Gene length (bp)1533
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09732 CactinC_cactus Cactus-binding C-terminus of cactin protein 9.1E-56 319 456
PF10312 Cactin_mid Conserved mid region of cactin 3.1E-47 49 235

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14342|YB3C_SCHPO Uncharacterized protein C2F12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.12c PE=4 SV=1 59 456 3.0E-52
sp|F4I2J8|CATIN_ARATH Cactin OS=Arabidopsis thaliana GN=CTN PE=1 SV=1 271 456 6.0E-51
sp|G5EG14|CATIN_CAEEL Cactin OS=Caenorhabditis elegans GN=cacn-1 PE=1 SV=1 293 456 6.0E-48
sp|Q9VR99|CATIN_DROME Cactin OS=Drosophila melanogaster GN=cactin PE=1 SV=3 294 456 4.0E-47
sp|B6KG46|CATIN_TOXGO Cactin OS=Toxoplasma gondii GN=CACTIN PE=1 SV=2 319 456 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14342|YB3C_SCHPO Uncharacterized protein C2F12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.12c PE=4 SV=1 59 456 3.0E-52
sp|F4I2J8|CATIN_ARATH Cactin OS=Arabidopsis thaliana GN=CTN PE=1 SV=1 271 456 6.0E-51
sp|G5EG14|CATIN_CAEEL Cactin OS=Caenorhabditis elegans GN=cacn-1 PE=1 SV=1 293 456 6.0E-48
sp|Q9VR99|CATIN_DROME Cactin OS=Drosophila melanogaster GN=cactin PE=1 SV=3 294 456 4.0E-47
sp|B6KG46|CATIN_TOXGO Cactin OS=Toxoplasma gondii GN=CACTIN PE=1 SV=2 319 456 1.0E-46
sp|Q8WUQ7|CATIN_HUMAN Cactin OS=Homo sapiens GN=CACTIN PE=1 SV=3 281 456 1.0E-46
sp|F1Q8W0|CATIN_DANRE Cactin OS=Danio rerio GN=cactin PE=2 SV=1 281 456 3.0E-45
sp|Q9CS00|CATIN_MOUSE Cactin OS=Mus musculus GN=Cactin PE=1 SV=2 278 456 4.0E-45
sp|Q8WUQ7|CATIN_HUMAN Cactin OS=Homo sapiens GN=CACTIN PE=1 SV=3 58 286 5.0E-14
sp|F1Q8W0|CATIN_DANRE Cactin OS=Danio rerio GN=cactin PE=2 SV=1 54 256 4.0E-12
sp|Q9CS00|CATIN_MOUSE Cactin OS=Mus musculus GN=Cactin PE=1 SV=2 58 260 1.0E-11
sp|Q9VR99|CATIN_DROME Cactin OS=Drosophila melanogaster GN=cactin PE=1 SV=3 54 248 1.0E-07
sp|F4I2J8|CATIN_ARATH Cactin OS=Arabidopsis thaliana GN=CTN PE=1 SV=1 60 235 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|65
MDPGRREMLAKQRPWNRKSATGPQHDAKTRVSKPSQRGAQGDSSRYLSQDQLARKFVDEEDDFVLKQSKKKADIR
VREGRATPHDHLVFNLRYIDRERHLFDDQDEDYGIELKAPGSVISELDLGQLRELQAGVESFLALEKEAVARAYW
SAVQVLCEDQLSRLDASNSEERRILEVVADDIDKILKAKKYEELEKLEKDIKSQLESDELIDADFWQQMLRETKA
RRSKMTLQRIFETIVEEQAKAAKLRPAKGAQDSKAAAAMDVDATAEGLASGPADEDVSQATRALYDRLASQAMLE
NEEIFTAEEAVPSVAKRQWTEEYTARKPRYFNRVQMGYEWNKYNQTHYDHSNPPPRVVQGYKFNIFYPDLIDNTK
TPTFKIIREHGRRRGESLAAAGEADTCLIHFIAGPPYADIAFRIVDREWDFSAKRDRGYKSTFENGVLQLHFQFK
KIFYRK*
Coding >OphauB2|65
ATGGATCCAGGCCGCCGTGAAATGCTTGCCAAGCAGCGTCCTTGGAATCGCAAAAGTGCCACGGGCCCTCAACAT
GATGCCAAGACACGCGTTAGCAAGCCGTCGCAGCGCGGGGCCCAAGGCGACTCGTCACGCTATCTATCCCAAGAC
CAGCTTGCGCGCAAGTTTGTCGATGAGGAGGATGACTTTGTGCTGAAGCAGTCCAAGAAGAAGGCGGATATCCGG
GTCCGCGAAGGACGAGCCACACCCCATGACCATCTCGTATTTAACCTGCGCTACATTGATCGTGAGCGCCATCTT
TTTGACGATCAAGACGAAGATTATGGCATTGAGCTCAAGGCGCCAGGGTCTGTAATCTCAGAACTCGACCTCGGT
CAATTGCGTGAGCTGCAGGCAGGAGTCGAGTCATTTCTGGCTCTGGAAAAGGAGGCCGTCGCCAGAGCATACTGG
TCGGCCGTGCAGGTTCTTTGCGAGGACCAATTGTCTAGGCTGGATGCCAGCAACTCTGAAGAACGCCGTATTCTT
GAAGTTGTTGCCGACGACATTGACAAGATTTTAAAGGCAAAAAAGTATGAGGAGCTGGAGAAGCTAGAAAAGGAC
ATCAAGAGCCAGCTTGAGTCGGATGAGCTGATTGATGCCGACTTTTGGCAACAGATGCTGCGTGAAACCAAGGCT
CGCAGAAGCAAAATGACGCTGCAACGCATATTTGAGACCATTGTTGAGGAACAGGCAAAAGCGGCCAAATTGCGG
CCAGCCAAAGGTGCACAGGATTCAAAGGCAGCGGCAGCCATGGATGTAGATGCTACTGCAGAAGGTCTGGCATCA
GGCCCAGCCGACGAAGATGTGTCGCAAGCCACAAGAGCTCTCTACGACAGGCTGGCCTCGCAGGCCATGCTGGAA
AACGAGGAAATCTTCACAGCCGAAGAGGCTGTGCCGAGCGTGGCAAAACGTCAGTGGACCGAAGAGTACACAGCG
CGAAAGCCGCGATACTTCAACCGGGTGCAAATGGGTTACGAGTGGAACAAGTACAACCAGACGCACTATGACCAC
AGCAACCCCCCGCCCAGGGTTGTCCAGGGCTACAAGTTCAACATTTTCTACCCAGATCTCATTGACAATACCAAG
ACGCCGACGTTTAAAATCATTCGCGAGCATGGCCGGCGGCGAGGCGAATCGTTGGCGGCCGCTGGCGAGGCGGAC
ACATGCCTCATTCACTTTATTGCAGGGCCACCATATGCTGACATTGCCTTTCGCATCGTCGATCGTGAATGGGAC
TTTAGTGCCAAACGGGACCGTGGTTACAAGAGCACTTTTGAAAATGGAGTCTTGCAGCTTCATTTCCAGTTCAAA
AAGATCTTTTACCGGAAATAG
Transcript >OphauB2|65
ATGGATCCAGGCCGCCGTGAAATGCTTGCCAAGCAGCGTCCTTGGAATCGCAAAAGTGCCACGGGCCCTCAACAT
GATGCCAAGACACGCGTTAGCAAGCCGTCGCAGCGCGGGGCCCAAGGCGACTCGTCACGCTATCTATCCCAAGAC
CAGCTTGCGCGCAAGTTTGTCGATGAGGAGGATGACTTTGTGCTGAAGCAGTCCAAGAAGAAGGCGGATATCCGG
GTCCGCGAAGGACGAGCCACACCCCATGACCATCTCGTATTTAACCTGCGCTACATTGATCGTGAGCGCCATCTT
TTTGACGATCAAGACGAAGATTATGGCATTGAGCTCAAGGCGCCAGGGTCTGTAATCTCAGAACTCGACCTCGGT
CAATTGCGTGAGCTGCAGGCAGGAGTCGAGTCATTTCTGGCTCTGGAAAAGGAGGCCGTCGCCAGAGCATACTGG
TCGGCCGTGCAGGTTCTTTGCGAGGACCAATTGTCTAGGCTGGATGCCAGCAACTCTGAAGAACGCCGTATTCTT
GAAGTTGTTGCCGACGACATTGACAAGATTTTAAAGGCAAAAAAGTATGAGGAGCTGGAGAAGCTAGAAAAGGAC
ATCAAGAGCCAGCTTGAGTCGGATGAGCTGATTGATGCCGACTTTTGGCAACAGATGCTGCGTGAAACCAAGGCT
CGCAGAAGCAAAATGACGCTGCAACGCATATTTGAGACCATTGTTGAGGAACAGGCAAAAGCGGCCAAATTGCGG
CCAGCCAAAGGTGCACAGGATTCAAAGGCAGCGGCAGCCATGGATGTAGATGCTACTGCAGAAGGTCTGGCATCA
GGCCCAGCCGACGAAGATGTGTCGCAAGCCACAAGAGCTCTCTACGACAGGCTGGCCTCGCAGGCCATGCTGGAA
AACGAGGAAATCTTCACAGCCGAAGAGGCTGTGCCGAGCGTGGCAAAACGTCAGTGGACCGAAGAGTACACAGCG
CGAAAGCCGCGATACTTCAACCGGGTGCAAATGGGTTACGAGTGGAACAAGTACAACCAGACGCACTATGACCAC
AGCAACCCCCCGCCCAGGGTTGTCCAGGGCTACAAGTTCAACATTTTCTACCCAGATCTCATTGACAATACCAAG
ACGCCGACGTTTAAAATCATTCGCGAGCATGGCCGGCGGCGAGGCGAATCGTTGGCGGCCGCTGGCGAGGCGGAC
ACATGCCTCATTCACTTTATTGCAGGGCCACCATATGCTGACATTGCCTTTCGCATCGTCGATCGTGAATGGGAC
TTTAGTGCCAAACGGGACCGTGGTTACAAGAGCACTTTTGAAAATGGAGTCTTGCAGCTTCATTTCCAGTTCAAA
AAGATCTTTTACCGGAAATAG
Gene >OphauB2|65
ATGGATCCAGGCCGCCGTGAAATGCTTGCCAAGCAGCGTCCTTGGAATCGCAAAAGTGCCACGGGCCCTCAACAT
GATGCCAAGACACGCGTTAGCAAGCCGTCGCAGCGCGGGGCCCAAGGCGACTCGTCACGCTATCTATCCCAAGAC
CAGCTTGCGCGCAAGTTTGTCGATGAGGAGGATGACTTTGTGCTGAAGCAGTCCAAGAAGAAGGCGGATATCCGG
GTCCGCGAAGGACGAGCCACACCCCATGACCATCTCGTATTTAACCTGCGCTACATTGATCGTGAGCGCCATCTT
TTTGACGATCAAGACGAAGATTATGGCATTGAGCTCAAGGCGCCAGGGTCTGTAATCTCAGAACTCGACCTCGGT
CAATTGCGTGAGCTGCAGGCAGGAGTCGAGTCATTTCTGGCTCTGGAAAAGGAGGCCGTCGCCAGAGCATACTGG
TCGGCCGTGCAGGTTCTTTGCGAGGACCAATTGTCTAGGCTGGATGCCAGCAACTCTGAAGAACGCCGTATTCTT
GAAGTTGTTGCCGACGACATTGACAAGATTTTAAAGGCAAAAAAGTATGAGGAGCTGGAGAAGCTAGAAAAGGAC
ATCAAGAGCCAGCTTGAGTCGGATGAGCTGATTGATGCCGACTTTTGGCAACAGATGCTGCGTGAAACCAAGGCT
CGCAGAAGCAAAATGACGCTGCAACGCATATTTGAGACCATTGTTGAGGAACAGGCAAAAGCGGCCAAATTGCGG
CCAGCCAAAGGTGCACAGGATTCAAAGGCAGCGGCAGCCATGGATGTAGATGCTACTGCAGAAGGTCTGGCATCA
GGCCCAGCCGACGAAGATGTGTCGCAAGCCACAAGAGCTCTCTACGACAGGCTGGCCTCGCAGGCCATGCTGGAA
AACGAGGAAATCTTCACAGCCGAAGAGGCTGTGCCGAGCGTGGCAAAACGTCAGTGGACCGAAGAGTACACAGCG
CGAAAGCCGCGATACTTCAACCGGGTGCAAATGGGTTACGAGTGGAACAAGTACAACCAGACGCACTATGACCAC
AGCAACCCCCCGCCCAGGGTTGTCCAGGGCTACAAGTTCAACATTTTCTACCCAGATCTCATTGACAATACCAAG
ACGCCGACGTTTAAAATCATTCGCGAGCATGGCCGGCGGCGAGGCGAATCGTTGGCGGCCGCTGGCGAGGCGGAC
ACATGCCTCATTCACTTTATTGCAGGGCCACCATATGCTGACATTGCCTTTCGCATCGTCGATCGTGAATGGGAC
TTTAGTGCCAAACGGGACCGTGGTTACAAGAGCACTTTTGAAAATGTGAGTCGAATCCAAGGGAGAAAAGGAGCA
CGACGAGGAGGACAAGTGCAAGGAGATAGACAAGAGAGATTCACGAGGGTGCTAACACGCATGTTTTTGCAGGGA
GTCTTGCAGCTTCATTTCCAGTTCAAAAAGGCATGTTACATGAGCAACCGACGGGAAGAGTGAGAGACGTCGCTA
ACTTTTGACCCAAAGATCTTTTACCGGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail