Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6497
Gene name
LocationContig_6:179106..180960
Strand+
Gene length (bp)1854
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00668 Condensation Condensation domain 2.1E-10 352 453
PF00550 PP-binding Phosphopantetheine attachment site 4.5E-11 65 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 25 521 3.0E-55
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 23 477 2.0E-44
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 5 525 4.0E-38
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 5 525 3.0E-37
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 3 551 3.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 25 521 3.0E-55
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 23 477 2.0E-44
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 5 525 4.0E-38
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 5 525 3.0E-37
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 3 551 3.0E-37
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 7 528 3.0E-32
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 259 470 1.0E-29
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 21 529 2.0E-29
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3 444 2.0E-26
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 53 527 2.0E-23
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 7 463 8.0E-23
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 7 433 6.0E-20
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 7 433 7.0E-20
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 7 433 5.0E-18
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 10 444 3.0E-17
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 25 433 3.0E-17
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 7 442 3.0E-17
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 29 477 3.0E-14
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 13 443 6.0E-14
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 23 130 1.0E-13
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 25 443 6.0E-13
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 10 336 7.0E-13
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 25 443 2.0E-12
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 23 324 4.0E-12
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 29 550 5.0E-12
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 25 328 6.0E-12
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 24 133 7.0E-12
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 23 546 1.0E-10
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 25 135 4.0E-10
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 25 135 4.0E-10
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 25 144 4.0E-10
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 25 126 4.0E-10
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 17 423 8.0E-10
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 27 126 2.0E-09
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 29 301 2.0E-09
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 23 300 2.0E-09
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1 148 2.0E-09
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 23 300 3.0E-09
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 28 128 3.0E-09
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 60 446 4.0E-09
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 25 126 9.0E-09
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 293 427 1.0E-08
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 13 128 1.0E-08
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 16 409 1.0E-08
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 23 130 2.0E-08
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2 407 2.0E-08
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 25 130 3.0E-08
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 25 137 3.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 256 461 4.0E-08
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 22 200 4.0E-08
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 25 424 5.0E-08
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 26 441 6.0E-08
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 25 424 6.0E-08
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 25 126 7.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 277 433 8.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 25 301 8.0E-08
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 25 126 1.0E-07
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 17 195 2.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 198 462 2.0E-07
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 23 131 2.0E-07
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 25 125 2.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 25 122 4.0E-07
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 25 126 4.0E-07
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 25 128 6.0E-07
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 23 128 6.0E-07
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 25 136 7.0E-07
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 25 131 8.0E-07
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 25 126 9.0E-07
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 25 129 9.0E-07
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 22 136 1.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 352 546 1.0E-06
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 23 130 1.0E-06
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 12 137 2.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 352 440 2.0E-06
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 25 137 3.0E-06
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 27 182 4.0E-06
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 25 127 4.0E-06
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 13 164 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6497
MDNEPPFLPPTQAHRDLVHGALKLLKNRLPAYMVPDVVIPLPYIPLSYQPRLAAKRPPETESEAVLQTIVAEVLK
LHPSDVGMDDGFFRLGGDSIIAIRLVERAQSQGFAFRVSNVFESPKLADLARFASRCNGNDLHVSEDSAQSLQLL
MDSADPEKVAHNLVSQGFSCSEHDIVQVLPMTQAAERFLFQTPEYWIVNLQGPVNLDRLQEACTALVVLEHVDTS
FKFYGTSQSIADSVDEYRLSDLLPLPTLNMLMTEFIMVQNIGGQDVKQALVVRLSHAQFDGVSLHTLWRDLKHLY
EDTSLPAATPYSHHLQQWRRSNYSFGDSPQDSPDVFVTGTRFVNIGQSIPRNITTATIVKTAWATLLAKLTGSSD
CVFAQISNGRNYDSSAAYNVVGACLNFIPVRANLNPTWTVLQLLEFMQQQHSASLAHELLDFGDIVQRSTPWPTG
TAHQSVVLHQNIEPDQVFQFGDAEAWVTCSYEWPHPPDEILVESLPTGNASLRVTLDTRSSTLSRRNVNLVLEKL
CRLIVLLPALADNADASVETLLAALD*
Coding >OphauB2|6497
ATGGACAATGAACCGCCGTTTCTTCCCCCAACTCAGGCGCACCGCGATCTAGTACATGGAGCCTTGAAGCTACTC
AAGAATCGACTTCCAGCCTACATGGTCCCTGATGTCGTGATTCCCTTGCCCTATATACCGCTCTCGTACCAGCCG
AGGCTTGCCGCCAAGCGTCCACCAGAGACCGAGTCTGAAGCTGTTTTACAGACTATTGTGGCCGAGGTATTAAAG
CTCCATCCCTCAGACGTGGGCATGGACGACGGCTTTTTTCGACTTGGCGGGGATTCGATAATTGCTATTCGCCTG
GTTGAGCGAGCTCAATCGCAGGGCTTTGCGTTCCGCGTGTCCAATGTCTTTGAAAGCCCAAAGCTGGCCGACTTG
GCTCGATTTGCGTCTCGTTGCAACGGAAATGATTTACATGTATCCGAGGACAGCGCGCAATCTTTGCAGCTGCTG
ATGGATTCAGCTGATCCGGAAAAGGTGGCGCACAATCTGGTATCCCAGGGCTTCTCATGCTCTGAGCACGATATT
GTCCAAGTTCTTCCCATGACACAGGCGGCAGAGAGATTTTTGTTTCAAACCCCCGAGTATTGGATTGTCAACTTG
CAAGGGCCGGTAAACCTTGATCGACTTCAAGAAGCGTGCACTGCCTTGGTAGTTTTGGAACACGTTGATACGAGC
TTTAAATTTTATGGCACGAGTCAAAGTATTGCGGATTCTGTTGACGAATATCGCCTTTCAGATCTTTTGCCTTTG
CCGACTCTCAACATGCTAATGACTGAATTTATCATGGTGCAAAATATTGGCGGTCAAGATGTCAAACAGGCCCTT
GTTGTTCGGCTTAGCCATGCGCAATTTGATGGAGTATCCCTGCACACGCTGTGGCGAGATTTGAAGCACCTCTAT
GAAGACACTAGCCTCCCCGCCGCTACGCCATACTCACACCACTTGCAGCAGTGGAGGCGCAGCAACTACTCGTTT
GGTGACTCGCCTCAAGACTCCCCCGACGTCTTTGTAACGGGCACCCGCTTCGTGAACATTGGACAAAGTATTCCT
CGCAACATTACGACTGCTACAATAGTAAAGACGGCATGGGCGACTCTCTTGGCCAAGCTGACTGGCTCCAGCGAC
TGCGTCTTTGCCCAGATATCCAACGGCCGCAACTACGACTCGTCGGCCGCGTACAATGTAGTAGGCGCCTGTCTC
AATTTTATACCCGTCCGTGCAAATCTCAACCCAACATGGACGGTGCTGCAACTCCTCGAGTTTATGCAGCAGCAG
CACAGTGCCAGCCTCGCGCACGAGTTGCTCGACTTTGGAGACATTGTGCAGCGCTCCACGCCGTGGCCGACGGGC
ACAGCCCACCAGAGCGTGGTGCTGCATCAAAACATTGAGCCCGATCAAGTTTTCCAGTTTGGCGACGCCGAGGCT
TGGGTGACGTGTTCGTACGAGTGGCCGCATCCGCCAGACGAGATTCTCGTCGAGTCTCTACCCACGGGTAATGCA
AGTCTGAGAGTGACGCTGGACACGCGGAGCAGTACTCTGAGTCGTCGAAATGTCAATCTTGTCTTGGAGAAGCTG
TGCCGCTTGATTGTGCTGTTGCCGGCTCTTGCTGACAATGCGGATGCAAGTGTGGAGACTTTGCTGGCAGCATTG
GATTAA
Transcript >OphauB2|6497
ATGGACAATGAACCGCCGTTTCTTCCCCCAACTCAGGCGCACCGCGATCTAGTACATGGAGCCTTGAAGCTACTC
AAGAATCGACTTCCAGCCTACATGGTCCCTGATGTCGTGATTCCCTTGCCCTATATACCGCTCTCGTACCAGCCG
AGGCTTGCCGCCAAGCGTCCACCAGAGACCGAGTCTGAAGCTGTTTTACAGACTATTGTGGCCGAGGTATTAAAG
CTCCATCCCTCAGACGTGGGCATGGACGACGGCTTTTTTCGACTTGGCGGGGATTCGATAATTGCTATTCGCCTG
GTTGAGCGAGCTCAATCGCAGGGCTTTGCGTTCCGCGTGTCCAATGTCTTTGAAAGCCCAAAGCTGGCCGACTTG
GCTCGATTTGCGTCTCGTTGCAACGGAAATGATTTACATGTATCCGAGGACAGCGCGCAATCTTTGCAGCTGCTG
ATGGATTCAGCTGATCCGGAAAAGGTGGCGCACAATCTGGTATCCCAGGGCTTCTCATGCTCTGAGCACGATATT
GTCCAAGTTCTTCCCATGACACAGGCGGCAGAGAGATTTTTGTTTCAAACCCCCGAGTATTGGATTGTCAACTTG
CAAGGGCCGGTAAACCTTGATCGACTTCAAGAAGCGTGCACTGCCTTGGTAGTTTTGGAACACGTTGATACGAGC
TTTAAATTTTATGGCACGAGTCAAAGTATTGCGGATTCTGTTGACGAATATCGCCTTTCAGATCTTTTGCCTTTG
CCGACTCTCAACATGCTAATGACTGAATTTATCATGGTGCAAAATATTGGCGGTCAAGATGTCAAACAGGCCCTT
GTTGTTCGGCTTAGCCATGCGCAATTTGATGGAGTATCCCTGCACACGCTGTGGCGAGATTTGAAGCACCTCTAT
GAAGACACTAGCCTCCCCGCCGCTACGCCATACTCACACCACTTGCAGCAGTGGAGGCGCAGCAACTACTCGTTT
GGTGACTCGCCTCAAGACTCCCCCGACGTCTTTGTAACGGGCACCCGCTTCGTGAACATTGGACAAAGTATTCCT
CGCAACATTACGACTGCTACAATAGTAAAGACGGCATGGGCGACTCTCTTGGCCAAGCTGACTGGCTCCAGCGAC
TGCGTCTTTGCCCAGATATCCAACGGCCGCAACTACGACTCGTCGGCCGCGTACAATGTAGTAGGCGCCTGTCTC
AATTTTATACCCGTCCGTGCAAATCTCAACCCAACATGGACGGTGCTGCAACTCCTCGAGTTTATGCAGCAGCAG
CACAGTGCCAGCCTCGCGCACGAGTTGCTCGACTTTGGAGACATTGTGCAGCGCTCCACGCCGTGGCCGACGGGC
ACAGCCCACCAGAGCGTGGTGCTGCATCAAAACATTGAGCCCGATCAAGTTTTCCAGTTTGGCGACGCCGAGGCT
TGGGTGACGTGTTCGTACGAGTGGCCGCATCCGCCAGACGAGATTCTCGTCGAGTCTCTACCCACGGGTAATGCA
AGTCTGAGAGTGACGCTGGACACGCGGAGCAGTACTCTGAGTCGTCGAAATGTCAATCTTGTCTTGGAGAAGCTG
TGCCGCTTGATTGTGCTGTTGCCGGCTCTTGCTGACAATGCGGATGCAAGTGTGGAGACTTTGCTGGCAGCATTG
GATTAA
Gene >OphauB2|6497
ATGGACAATGAACCGCCGTTTCTTCCCCCAACTCAGGCGCACCGCGATCTAGTACATGGAGCCTTGAAGCTACTC
AAGAATCGACTTCCAGCCTACATGGTCCCTGATGTCGTGATTCCCTTGCCCTATATACCGCTCTCGGTCAGTGGC
AAGGCAGATCGTCGGCTGCTCTGTCGCAAGGCGGCCGCTCTCTCACCGTCCGAGATTGAGCAGTACCAGCCGAGG
CTTGCCGCCAAGCGTCCACCAGAGACCGAGTCTGAAGCTGTTTTACAGACTATTGTGGCCGAGGTATTAAAGCTC
CATCCCTCAGACGTGGGCATGGACGACGGCTTTTTTCGACTTGGCGGGGATTCGATAATTGCTATTCGCCTGGTT
GAGCGAGCTCAATCGCAGGGCTTTGCGTTCCGCGTGTCCAATGTCTTTGAAAGCCCAAAGCTGGCCGACTTGGCT
CGATTTGCGTCTCGTTGCAACGGAAATGATTTACATGTATCCGAGGACAGCGCGCAATCTTTGCAGCTGCTGATG
GATTCAGCTGATCCGGAAAAGGTGGCGCACAATCTGGTATCCCAGGGCTTCTCATGCTCTGAGCACGATATTGTC
CAAGTTCTTCCCATGACACAGGCGGCAGAGAGATTTTTGTTTCAAACCCCCGAGTATTGGATTGTCAACTTGCAA
GGGCCGGTAAACCTTGATCGACTTCAAGAAGCGTGCACTGCCTTGGTGCGTCGGCACGGCATTTTGCGGAGCGTC
TTTACCAGGATACAAAATAACCATGTCCAGGTAGTTTTGGAACACGTTGATACGAGCTTTAAATTTTATGGCACG
AGTCAAAGTATTGCGGATTCTGTTGACGAATATCGCCTTTCAGATCTTTTGCCTTTGCCGACTCTCAACATGCTA
ATGACTGAATTTATCATGGTGCAAAATATTGGCGGTCAAGATGTCAAACAGGCCCTTGTTGTTCGGCTTAGCCAT
GCGCAATTTGATGGAGTATCCCTGCACACGCTGTGGCGAGATTTGAAGCACCTCTATGAAGACACTAGCCTCCCC
GCCGCTACGCCATACTCACACCACTTGCAGCAGTGGAGGCGCAGTCAGACAAGAGATGGTTTCGCCTTTTGGAAA
GACACACTGCAAGGAAGCTCAGTCACAAGAATAGGCAACTACTCGTTTGGTGACTCGCCTCAAGACTCCCCCGAC
GTCTTTGTAACGGGCACCCGCTTCGTGAACATTGGACAAAGTATTCCTCGCAACATTACGACTGCTACAATAGTA
AAGACGGCATGGGCGACTCTCTTGGCCAAGCTGACTGGCTCCAGCGACTGCGTCTTTGCCCAGATATCCAACGGC
CGCAACTACGACTCGTCGGCCGCGTACAATGTAGTAGGCGCCTGTCTCAATTTTATACCCGTCCGTGCAAATCTC
AACCCAACATGGACGGTGCTGCAACTCCTCGAGTTTATGCAGCAGCAGCACAGTGCCAGCCTCGCGCACGAGTTG
CTCGACTTTGGAGACATTGTGCAGCGCTCCACGCCGTGGCCGACGGGCACAGCCCACCAGAGCGTGGTGCTGCAT
CAAAACATTGAGCCCGATCAAGTTTTCCAGTTTGGCGACGCCGAGGCTTGGGTGACGTGTTCGTACGAGTGGCCG
CATCCGCCAGACGAGATTCTCGTCGAGTCTCTACCCACGGGTAATGCAAGTCTGAGAGTGACGCTGGACACGCGG
AGCAGTACTCTGAGTCGTCGAAATGTCAATCTTGTCTTGGAGAAGCTGTGCCGCTTGATTGTGCTGTTGCCGGCT
CTTGCTGACAATGCGGATGCAAGTGTGGAGACTTTGCTGGCAGCATTGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail