Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6494
Gene name
LocationContig_6:169059..177890
Strand+
Gene length (bp)8831
Transcript length (bp)8760
Coding sequence length (bp)8760
Protein length (aa) 2920

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 3.7E-73 710 1105
PF00501 AMP-binding AMP-binding enzyme 4.0E-64 1772 2170
PF00668 Condensation Condensation domain 3.5E-35 278 683
PF00668 Condensation Condensation domain 1.9E-23 1348 1752
PF00668 Condensation Condensation domain 9.6E-38 2422 2827
PF00550 PP-binding Phosphopantetheine attachment site 1.7E-09 173 233
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-10 1244 1307
PF00550 PP-binding Phosphopantetheine attachment site 3.9E-11 2319 2377

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 273 2900 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 2375 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 698 2554 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 1325 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 699 2768 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 273 2900 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 2375 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 698 2554 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 1325 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 699 2768 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1 1605 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 681 2604 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1 1605 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 681 2604 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1 1605 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1 2730 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 270 2911 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 439 2397 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1 1406 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1756 2900 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 684 2480 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1 1509 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 272 1642 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1706 2911 6.0E-180
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1756 2844 1.0E-177
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1764 2892 2.0E-174
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1764 2892 4.0E-174
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1764 2892 8.0E-172
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 614 1787 8.0E-170
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1 2905 2.0E-167
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1 2905 3.0E-167
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 276 2375 9.0E-166
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1 2905 5.0E-165
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1 2412 4.0E-163
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 239 2823 4.0E-163
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1 2598 4.0E-163
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 274 2905 9.0E-163
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 275 2404 1.0E-160
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1 2905 2.0E-160
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1318 2821 3.0E-160
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 276 2379 6.0E-159
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1 2374 1.0E-158
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 275 2384 2.0E-155
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 272 2903 2.0E-155
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1 2905 2.0E-155
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 274 2905 1.0E-154
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 276 2605 2.0E-154
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 274 2905 7.0E-154
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1 2723 1.0E-153
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1 2412 3.0E-153
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1314 2911 1.0E-152
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 274 2187 6.0E-152
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1 2384 1.0E-151
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 270 2385 1.0E-151
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 275 2380 3.0E-151
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1 2393 3.0E-149
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1 2457 6.0E-149
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 272 2911 8.0E-149
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 275 2594 2.0E-148
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 270 2901 8.0E-148
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 272 2594 1.0E-146
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1 2377 1.0E-145
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1 2457 5.0E-145
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 276 2392 1.0E-144
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 647 2903 8.0E-143
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 276 1640 1.0E-142
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 714 2887 1.0E-140
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 702 2741 1.0E-138
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1 1669 1.0E-136
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4 1325 3.0E-135
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 635 2905 3.0E-133
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1 2569 6.0E-133
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1 2369 2.0E-132
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1 2369 1.0E-131
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1 2482 8.0E-126
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 714 2727 2.0E-125
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1 2376 8.0E-125
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1345 2902 1.0E-124
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 497 1638 4.0E-124
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 280 2389 2.0E-122
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1335 2722 1.0E-119
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 697 1658 2.0E-118
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1 1603 5.0E-118
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 690 2889 1.0E-116
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 692 2375 3.0E-116
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 673 2598 2.0E-114
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 689 2598 6.0E-114
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 701 2375 1.0E-112
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 670 1294 5.0E-112
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 656 2889 6.0E-112
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1562 2739 2.0E-110
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 475 1438 2.0E-108
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1749 2917 3.0E-108
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1344 2905 4.0E-103
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1 1631 3.0E-101
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1 1309 7.0E-101
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1346 2906 1.0E-100
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 726 2375 2.0E-99
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 273 1285 6.0E-99
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1767 2745 1.0E-98
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1335 2905 2.0E-98
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1346 2900 9.0E-98
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1 1307 2.0E-97
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 228 1218 5.0E-97
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1 1481 8.0E-97
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1756 2397 6.0E-95
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1 1482 1.0E-94
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1 1309 4.0E-94
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 696 2670 2.0E-92
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1 1309 4.0E-92
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1345 2905 4.0E-92
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1347 2903 2.0E-91
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 181 1641 2.0E-91
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 1482 3.0E-91
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 240 1310 1.0E-90
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 275 1308 1.0E-90
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1347 2905 2.0E-90
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1 1489 2.0E-90
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 1482 7.0E-90
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1721 2366 1.0E-89
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1 1482 2.0E-89
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 1303 3.0E-89
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1 1329 3.0E-89
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1 1493 1.0E-88
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1 705 6.0E-88
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1 1481 1.0E-87
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1343 2906 3.0E-87
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 274 1329 3.0E-87
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1345 2906 1.0E-86
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1 1481 5.0E-86
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1 1510 3.0E-85
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 671 1319 4.0E-83
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1347 2892 1.0E-82
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1 1315 2.0E-82
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1766 2561 3.0E-82
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1 1304 4.0E-81
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1344 2290 5.0E-81
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 275 1315 9.0E-81
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 240 1282 2.0E-80
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1347 2898 6.0E-80
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1725 2889 6.0E-80
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 272 1308 6.0E-80
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1718 2889 2.0E-78
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1718 2889 2.0E-78
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 642 1658 6.0E-78
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1347 2901 1.0E-77
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1347 2906 2.0E-77
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1347 2905 7.0E-77
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1 1406 9.0E-77
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1 1406 2.0E-76
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1186 2729 5.0E-76
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 166 1624 3.0E-75
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 114 1320 3.0E-75
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 263 1307 7.0E-75
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1343 2375 5.0E-74
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 725 1745 1.0E-73
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1704 2889 1.0E-73
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 665 1313 6.0E-73
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 631 1308 1.0E-72
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 675 1481 4.0E-71
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1344 2375 8.0E-71
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1711 2911 2.0E-70
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1340 2407 2.0E-70
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 675 1481 2.0E-70
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1347 2388 4.0E-70
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1200 2823 9.0E-69
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1347 2377 7.0E-68
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1 1405 3.0E-67
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 373 1308 1.0E-66
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1351 2905 2.0E-66
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1347 2375 4.0E-66
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1766 2823 5.0E-66
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1460 2905 7.0E-66
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 631 1481 1.0E-65
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1763 2905 1.0E-65
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 281 1290 2.0E-65
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1766 2907 4.0E-65
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1751 2392 8.0E-65
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1761 2393 2.0E-64
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1761 2393 2.0E-63
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 665 1404 3.0E-62
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1769 2382 2.0E-61
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 108 1606 6.0E-61
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1371 2378 1.0E-58
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 815 2375 6.0E-58
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 660 1603 2.0E-57
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1669 2376 5.0E-57
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1460 2898 6.0E-57
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1767 2906 7.0E-57
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 713 1305 8.0E-57
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 377 1118 2.0E-56
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1424 2348 6.0E-56
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1754 2889 9.0E-56
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1755 2380 2.0E-55
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1767 2905 4.0E-54
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1 1119 6.0E-54
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2082 2738 2.0E-52
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 699 1314 2.0E-49
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 987 1655 5.0E-49
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 4 576 8.0E-49
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 576 2.0E-48
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 601 1344 3.0E-48
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1767 2375 1.0E-47
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1456 2375 1.0E-47
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1 576 2.0E-45
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 717 1677 8.0E-45
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1785 2888 2.0E-43
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1 596 4.0E-43
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 688 1309 3.0E-42
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 688 1309 3.0E-42
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 635 1311 5.0E-42
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 631 1314 8.0E-42
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 688 1309 1.0E-41
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 631 1314 3.0E-41
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1769 2687 4.0E-41
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1432 2228 4.0E-41
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 704 1216 6.0E-41
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 714 1216 1.0E-40
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 714 1216 1.0E-40
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 714 1216 2.0E-40
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 714 1216 2.0E-40
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 714 1216 2.0E-40
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 677 1314 2.0E-40
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 677 1314 2.0E-40
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 714 1216 2.0E-40
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 714 1216 2.0E-40
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 714 1216 2.0E-40
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 714 1216 2.0E-40
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 677 1314 2.0E-40
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 687 1214 2.0E-40
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 714 1216 3.0E-40
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 714 1216 3.0E-40
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 714 1216 3.0E-40
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 714 1216 5.0E-40
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 714 1216 2.0E-39
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 714 1213 3.0E-39
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 701 1315 8.0E-39
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 706 1216 1.0E-38
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2421 2900 1.0E-38
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2420 2911 1.0E-38
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 704 1213 8.0E-38
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 714 1212 3.0E-37
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2421 2905 2.0E-36
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 634 1308 2.0E-36
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 714 1212 3.0E-36
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 637 1311 4.0E-36
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1738 2279 2.0E-35
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 714 1212 3.0E-35
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 714 1212 4.0E-35
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 714 1212 5.0E-35
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1762 2377 5.0E-35
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1767 2410 1.0E-34
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 713 1216 1.0E-34
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1767 2410 2.0E-34
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1767 2410 2.0E-34
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1815 2753 2.0E-34
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2412 2905 3.0E-34
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 678 1311 2.0E-33
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1767 2417 2.0E-33
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 4 593 3.0E-33
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 704 1213 4.0E-33
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 715 1310 5.0E-33
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 704 1213 5.0E-33
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 672 1309 6.0E-33
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 713 1216 7.0E-33
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1727 2377 1.0E-32
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 712 1216 3.0E-32
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 712 1216 5.0E-32
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 712 1216 5.0E-32
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 712 1216 5.0E-32
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 712 1216 5.0E-32
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 712 1216 5.0E-32
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 712 1216 5.0E-32
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 712 1216 5.0E-32
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 713 1211 5.0E-32
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1699 2378 5.0E-32
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 712 1216 9.0E-32
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 712 1216 9.0E-32
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 712 1216 9.0E-32
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 712 1216 9.0E-32
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 712 1216 9.0E-32
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 712 1216 9.0E-32
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1 576 1.0E-31
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1 576 2.0E-31
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 706 1214 3.0E-31
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1766 2369 3.0E-31
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1770 2280 4.0E-31
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 712 1216 4.0E-31
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1 576 4.0E-31
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1766 2369 4.0E-31
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1765 2288 6.0E-31
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1791 2283 8.0E-31
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1720 2378 8.0E-31
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1775 2288 1.0E-30
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1187 1627 1.0E-30
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1720 2378 3.0E-30
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1775 2288 3.0E-30
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1751 2394 3.0E-30
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2420 2905 6.0E-30
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1795 2283 1.0E-29
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 709 1213 1.0E-29
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1795 2283 3.0E-29
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1778 2280 3.0E-29
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 712 1211 3.0E-29
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2131 2686 4.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 727 1214 7.0E-29
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1791 2283 8.0E-29
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1767 2372 2.0E-28
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1787 2284 2.0E-28
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 678 1278 2.0E-28
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1791 2283 3.0E-28
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2421 2905 3.0E-28
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 713 1211 3.0E-28
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1787 2284 3.0E-28
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 704 1211 3.0E-28
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 704 1211 3.0E-28
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 704 1211 3.0E-28
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 713 1211 4.0E-28
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 704 1211 4.0E-28
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 704 1211 4.0E-28
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 704 1211 4.0E-28
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 704 1211 4.0E-28
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1702 2280 5.0E-28
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1791 2283 6.0E-28
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 704 1211 8.0E-28
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 704 1211 8.0E-28
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 704 1211 8.0E-28
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 713 1211 1.0E-27
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 706 1211 1.0E-27
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1765 2283 2.0E-27
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 690 1339 3.0E-27
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1765 2283 5.0E-27
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1765 2283 5.0E-27
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2418 2905 5.0E-27
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1765 2283 6.0E-27
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1787 2284 6.0E-27
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2420 2905 7.0E-27
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1765 2283 8.0E-27
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 636 1145 9.0E-27
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1 529 1.0E-26
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1771 2279 1.0E-26
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1765 2283 2.0E-26
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1765 2283 2.0E-26
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1765 2283 2.0E-26
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2418 2905 2.0E-26
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 727 1214 3.0E-26
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1 542 3.0E-26
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1765 2283 4.0E-26
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1510 2372 4.0E-26
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2421 2906 4.0E-26
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 769 1119 4.0E-26
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1765 2283 5.0E-26
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1765 2283 5.0E-26
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1765 2283 5.0E-26
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1765 2283 5.0E-26
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1778 2288 5.0E-26
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1259 1666 6.0E-26
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1757 2376 6.0E-26
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 714 1213 6.0E-26
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2 233 9.0E-26
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1765 2283 1.0E-25
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1765 2283 1.0E-25
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1765 2283 1.0E-25
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2385 2905 3.0E-25
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1733 2367 3.0E-25
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2416 2905 3.0E-25
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2416 2906 3.0E-25
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1778 2288 3.0E-25
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1778 2288 3.0E-25
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1778 2288 3.0E-25
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1778 2288 3.0E-25
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1778 2288 3.0E-25
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1778 2288 3.0E-25
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1778 2288 3.0E-25
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 727 1214 3.0E-25
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 727 1214 3.0E-25
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 727 1214 3.0E-25
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 727 1214 3.0E-25
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2421 2905 3.0E-25
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 701 1214 4.0E-25
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 753 1279 4.0E-25
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2418 2906 5.0E-25
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 701 1214 5.0E-25
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 701 1214 5.0E-25
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1778 2288 6.0E-25
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 727 1214 8.0E-25
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 727 1214 8.0E-25
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2416 2906 2.0E-24
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1778 2288 3.0E-24
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1778 2288 3.0E-24
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1778 2288 3.0E-24
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1778 2288 3.0E-24
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1778 2288 3.0E-24
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1778 2288 3.0E-24
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1765 2284 3.0E-24
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 117 543 4.0E-24
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2294 2744 4.0E-24
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1790 2372 7.0E-24
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 182 596 1.0E-23
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1792 2285 3.0E-23
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2420 2901 4.0E-23
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2418 2905 4.0E-23
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1 458 7.0E-23
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 95 576 1.0E-22
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1221 1688 1.0E-22
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1 545 2.0E-22
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1790 2366 2.0E-22
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2416 2823 2.0E-22
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1 356 3.0E-22
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2420 2911 4.0E-22
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2257 2900 6.0E-22
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1792 2285 7.0E-22
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1227 1676 8.0E-22
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1 529 1.0E-21
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1792 2285 1.0E-21
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1792 2285 1.0E-21
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1761 2285 1.0E-21
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1761 2285 1.0E-21
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2420 2905 2.0E-21
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1792 2285 2.0E-21
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1792 2285 2.0E-21
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1792 2285 2.0E-21
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1792 2285 2.0E-21
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1792 2285 2.0E-21
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1792 2285 2.0E-21
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1792 2285 2.0E-21
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1792 2285 2.0E-21
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2420 2905 3.0E-21
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1792 2285 4.0E-21
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1792 2285 4.0E-21
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1792 2285 4.0E-21
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1761 2285 4.0E-21
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1761 2285 4.0E-21
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1761 2285 4.0E-21
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1761 2285 4.0E-21
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1779 2280 7.0E-21
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1761 2285 1.0E-20
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1766 2280 1.0E-20
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1 243 2.0E-20
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1 238 4.0E-20
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2243 2610 4.0E-20
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2313 2816 5.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1816 2370 7.0E-20
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1792 2285 1.0E-19
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1 233 2.0E-19
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 713 1214 7.0E-19
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 270 660 8.0E-19
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1750 2187 1.0E-18
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1 233 5.0E-18
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1 562 6.0E-18
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 337 1.0E-17
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1 233 1.0E-17
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1 237 1.0E-17
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1259 1640 2.0E-17
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1 233 2.0E-17
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1836 2186 2.0E-17
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1 233 3.0E-17
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1 317 7.0E-17
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1 461 8.0E-17
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1 607 1.0E-16
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1 576 2.0E-16
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2443 2900 3.0E-16
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1307 1640 3.0E-16
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 158 576 6.0E-16
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2321 2686 2.0E-15
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1 246 2.0E-15
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2 212 2.0E-15
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 725 1278 3.0E-15
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2300 2901 3.0E-15
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2322 2721 4.0E-15
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 715 1221 4.0E-15
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1 237 5.0E-15
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2 233 6.0E-15
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2 233 6.0E-15
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2 233 6.0E-15
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1182 1475 8.0E-15
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1766 2350 8.0E-15
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 197 777 1.0E-14
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 719 1213 1.0E-14
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 253 616 2.0E-14
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 704 1217 2.0E-14
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 704 1220 2.0E-14
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 724 1155 2.0E-14
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 716 1211 3.0E-14
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 704 1220 4.0E-14
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1 233 4.0E-14
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2639 2911 4.0E-14
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 1829 2280 6.0E-14
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2580 2911 7.0E-14
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 1789 2283 9.0E-14
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1 353 9.0E-14
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1 233 1.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1239 1638 1.0E-13
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2391 2685 1.0E-13
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2331 2723 2.0E-13
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1348 1724 2.0E-13
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 846 1282 2.0E-13
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2 236 3.0E-13
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2 236 3.0E-13
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2422 2800 4.0E-13
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 727 1155 4.0E-13
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 1776 2283 5.0E-13
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 839 1119 5.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 158 541 1.0E-12
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 725 1120 1.0E-12
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 721 1152 1.0E-12
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 275 548 2.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 708 1211 2.0E-12
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 1789 2280 2.0E-12
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2314 2740 3.0E-12
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2 233 3.0E-12
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1 233 4.0E-12
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 673 1152 5.0E-12
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1 233 5.0E-12
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 816 1220 6.0E-12
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 109 233 7.0E-12
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 1731 2283 1.0E-11
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 842 1215 1.0E-11
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 700 1212 1.0E-11
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 94 363 2.0E-11
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1347 1612 2.0E-11
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 816 1220 2.0E-11
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 1790 2308 2.0E-11
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1182 1434 3.0E-11
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 1900 2186 4.0E-11
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 816 1157 5.0E-11
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 725 1214 5.0E-11
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 717 1307 8.0E-11
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 725 1214 8.0E-11
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 717 1217 8.0E-11
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 725 1065 8.0E-11
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 693 1212 8.0E-11
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 816 1157 1.0E-10
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 816 1157 1.0E-10
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 816 1157 1.0E-10
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 816 1220 1.0E-10
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 816 1157 1.0E-10
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 816 1157 1.0E-10
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 816 1155 1.0E-10
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 816 1155 1.0E-10
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 816 1155 1.0E-10
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 816 1157 1.0E-10
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 816 1157 1.0E-10
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 816 1157 1.0E-10
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 726 1119 2.0E-10
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 842 1215 2.0E-10
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 842 1215 2.0E-10
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 842 1215 2.0E-10
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 842 1215 2.0E-10
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 693 1116 2.0E-10
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 693 1116 2.0E-10
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 816 1157 2.0E-10
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 816 1157 2.0E-10
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 816 1157 2.0E-10
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 816 1157 2.0E-10
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 816 1157 2.0E-10
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 1910 2204 3.0E-10
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 816 1153 3.0E-10
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 816 1155 3.0E-10
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 842 1215 3.0E-10
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 842 1215 3.0E-10
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 816 1155 3.0E-10
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1 233 4.0E-10
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 816 1155 4.0E-10
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 727 1155 5.0E-10
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 1779 2280 5.0E-10
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 719 1119 5.0E-10
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 702 1119 7.0E-10
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 816 1155 8.0E-10
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 816 1155 8.0E-10
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 816 1155 8.0E-10
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 721 1119 1.0E-09
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 721 1064 1.0E-09
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 1907 2280 1.0E-09
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 721 1064 1.0E-09
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 816 1207 1.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2423 2905 1.0E-09
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 733 1218 2.0E-09
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 696 1213 2.0E-09
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 842 1215 2.0E-09
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 842 1215 2.0E-09
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 1777 2185 3.0E-09
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 726 1217 4.0E-09
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 725 1208 4.0E-09
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2841 2913 4.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1759 2185 5.0E-09
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2 244 5.0E-09
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2642 2911 5.0E-09
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 726 1212 7.0E-09
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 841 1215 8.0E-09
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 1783 2283 8.0E-09
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 726 1212 9.0E-09
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 1905 2280 9.0E-09
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 719 1141 1.0E-08
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 841 1241 1.0E-08
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 726 1212 1.0E-08
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1904 2283 1.0E-08
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 1785 2184 1.0E-08
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2098 2290 2.0E-08
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 816 1155 2.0E-08
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 800 1225 2.0E-08
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 726 1212 2.0E-08
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 719 1119 2.0E-08
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 726 1212 2.0E-08
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 726 1212 2.0E-08
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2 227 2.0E-08
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 1907 2186 2.0E-08
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 816 1116 3.0E-08
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 816 1222 3.0E-08
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 726 1212 3.0E-08
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 1904 2283 3.0E-08
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 843 1233 3.0E-08
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1 233 3.0E-08
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 725 1152 3.0E-08
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1911 2477 3.0E-08
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 726 1212 4.0E-08
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 726 1212 4.0E-08
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 719 1119 4.0E-08
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 1779 2280 4.0E-08
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2443 2905 4.0E-08
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2761 2911 4.0E-08
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 714 1214 5.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 99 237 5.0E-08
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1 233 6.0E-08
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 727 1213 6.0E-08
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1767 2185 7.0E-08
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 721 1064 7.0E-08
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 726 1212 7.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1183 1316 7.0E-08
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 233 8.0E-08
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 1769 2181 8.0E-08
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 1769 2181 8.0E-08
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 726 1212 9.0E-08
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 704 1116 1.0E-07
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 704 1116 1.0E-07
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 832 1119 1.0E-07
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 1898 2283 1.0E-07
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 1904 2283 1.0E-07
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 725 1064 1.0E-07
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 1898 2283 1.0E-07
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 1898 2283 1.0E-07
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 99 237 1.0E-07
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 721 1161 2.0E-07
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 1770 2284 2.0E-07
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 1898 2283 2.0E-07
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 1898 2283 2.0E-07
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 1898 2283 2.0E-07
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 1898 2283 2.0E-07
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 1898 2283 2.0E-07
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 1898 2283 2.0E-07
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 2015 2280 2.0E-07
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2229 2397 2.0E-07
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1183 1316 2.0E-07
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 1761 2280 2.0E-07
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 1761 2280 2.0E-07
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 819 1119 3.0E-07
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 711 1212 3.0E-07
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 725 1213 3.0E-07
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1 213 3.0E-07
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 1904 2292 4.0E-07
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 727 1064 5.0E-07
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 1898 2283 6.0E-07
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 725 1064 6.0E-07
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1764 2285 7.0E-07
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 719 1119 8.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2241 2380 1.0E-06
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 1911 2290 1.0E-06
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 711 1169 1.0E-06
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 1786 2280 1.0E-06
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 719 1119 1.0E-06
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2798 2911 1.0E-06
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 1874 2289 2.0E-06
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 711 1212 2.0E-06
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 711 1212 2.0E-06
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 1910 2288 2.0E-06
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 1759 2289 3.0E-06
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 727 1139 3.0E-06
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 676 860 3.0E-06
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 711 1212 3.0E-06
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 1779 2280 3.0E-06
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2245 2380 3.0E-06
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 711 1212 4.0E-06
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 711 1212 4.0E-06
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 1779 2186 5.0E-06
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 711 1212 5.0E-06
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 711 1212 6.0E-06
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 711 1212 8.0E-06
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 711 1212 9.0E-06
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 711 1212 9.0E-06
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 1786 2283 1.0E-05
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 1786 2283 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6494
MYCTGDFVQYVGDGVLRYIGRRDSQEKINGQRLELRDVEHGLNQVLPEPCRPLAAIIRPVDDSPPILAGFVQLPG
IEDSTNGRTEPLHGIFAYPSQYFRQMAERATVELASRLPRYMIPAVMIQLTVIPTTPTGKSNRREVARLASKLTK
RELDGFMRGSGEQMAPETDMEKQLYRLVEQVLHVDDFGMNDSFFRLGGDSIKAMQLVRQARELAGLEFTLDNMFK
CPVLSDLALTMRPYREQVDVAPFSLLAGSSSVHEILVMARNMCRLSSVDEIDDVYPCTQLQEGIMALSMSSTQAK
YVTTSTYTLPRAIELDRLKAAWDMVITKTAILRTRIIQGPFEQALQVVLKQGVEWQQATDMEHLKRQREQWRVEL
GGPLFRLVLLQSSGQLHLAVFISHAIYDGWSLPETLAQVETAYRGENVDSKPFSHFIQHTQSLDMALAKTFWETH
LAGFSEQSFPRAPANYRAASTATLKRSLCLKESKTALDSSLPRLVSLAWAMTVSQYTGSDDVCFGMTLAGRNVPV
PDIDRILAPTITTIPLRVRLDTSHTVQHTLSLLQKQFIDTMPFEHTGLQRIATFGPGAAAACRFQNHVVIQPPRA
DSTSEIFADEDKKEVDDNYILSIAVTLPAAESTTLHVEAVYHDQIVSEWLANKMADQLCHNILHMAMNQSTTLGN
LTSMPDTGLATIMNWNGQLPVAVDSCVHDLVGQHCVCQPDAIAVDAHDGSLSYRDLDTRATKLAAHLQALGVGPG
AYILVMMERSLWAVIAIMGIIKAGAAFVIMDPSIPDFRLRQIRQNTEAGIVLASMKHATRVLELGLQAVIVNCEQ
GWLKSLAHFTTPTVSPDDAVYVVYTSGSTGQPKGVVIQQRALATAATINGAHFKIDKTTRLLHVASFAFDASIAE
IFYALVHGGCVCIPSEAESRNSLEDAMNRFQVSWATLTPSLARAMSPSKLNTLQVLAVGGEALTKADIIMWADRI
HLMNGYGPAEATIDSTIQQHVSLGKSHSNIGHGAATRTWIMAAQDATCSKLMPLGAVGELVLEGPVLAKGYLKDT
AKTTSSFMEYPDWLRQLRHGKNGRLYKTGDLVQYSPSGDGSLLYMGRKDNQVKLRGQRLELGEVEQHLLECLPAA
EQVIAEVVEPRDAEPALAAYCFFRRDNETTCETRVLGPMESAMSAQFNDAETRMLCRVPGYMVPTLFLPLARVPL
STTGKADRRLLRELASSMSTRELKMYSKTAVQKRPPSSSKERIIQRKASDVLRLVLDEVGMNDNFFQLGGDSIAA
MKLAGAVRDSGFHVTVADIFSHPRLGDLAARLEKSDAGSAPKIAPFELLPETKRPSIMQAAASQCQVDVNTIQDL
YPCTPMQEALLALAMKQSGQYVAELTFDLGHDVDVDRVKAAWEAVYAASSILRTRIIPPLTSLDSSLQVVIKEPL
FWSSDSHPLEAENGKALHKAAIYHEAGQGKLRIWLHHALYDGTSLPLLLEQAEAAYNGCSPLSKPFNIFAAYTQT
LNGEEGRQFWEGEMKGLNTTMFPLLRSPHLSGKREFVSCDISIPNVKGSEFTLPSLIHSVCAASLGHFANTDDVV
YGITLAGRDAPVDGIESLIGPTMTTVPFRVQPWPKWSMQELMLDIQDRLARLMPFEHTGLQAIRQFSAECAVACD
FDCHVVIQPADEGTENKVFKETARSDDVYSNFSNSPLLLVFTLSADRRSVHLVVNFDVSHLDAVEATNFAQHLDH
GIQQAMLDATLPVEKIQMASPHHMALLENRNALVPPRLDMLVHELVAEQCRRRPSAQAVASWDGSLTYGQLDNFS
AMLAQHLLTHGAGPGKVAALCMPKSQWAVVAVLSALKSGSACAMMDASHPKGRMQEIVNQTSAAIVLASPETRET
AQAIAAGAMVVVVSPALLHGLPAPDSKICSAVTCSDVACIFFTSGSTGKSKGFTLEHASISTGLRDLRGPLGWDQ
DSRMLHFASYAFDMGLLELLGSMAVGACLCIPSDTDRMSNLCGFIEAKQVNWGFMIPSTSHLLDALSVPSLKTLV
MGGEAPKLADIQRWAARKDVRLLNLYGPAECMVGVTCGLMSPTEWIHGLSGHVVNGVGWIASPRDPSQLCAVGAM
GELLVEGAHLAREYLGDAEKTSASFIPSPPWLTRFRGHDGNRLYRTGDLFQLMSNGSVRFIGRKDRQVKLNGQRI
EPQEVESNLMALFPQDTMVIVDVVVQKSPAPRQRLVAFIHVADGKPKPCFSSHQDSLFASPDIDLLKLCRAAKQK
ISESLPRYMIPETFIPLTRVPRTVSGKINRGLLCDAASTLQGPDLDRLSGLATIESRPLDKLETDMAVLWTDVLG
LQLDAVSANENFFHVGGDSITAMKLVGAARSQGISMTVPQIFAHPRLADLVRVAKFDSKVNGVEAAIEPFSLLAE
HEREVVLKTAERQCLLPRTQIEDIYPCTPLQEALVSQSMRSSSAYMGRFRYKLGSQVDVSRFTQAWSHVVRANPI
LRTRMIQTLAMYQVVLLEEATFETVDSDSLDGFESQLQKDGIQMGCPLLQLVLSQPKTCGVDVEFCLLLHHALYD
AWSIDLILGQVRQAYAGKTPVCQPFNRFIDYTVRQKQDAMESYWLKQLSDASQVVFPALPRSDYKPFTDSDIRQE
VQVVPVLGITFATLLEFSWAATLSQYCDSGGVTHGLVLSGRNANVAGIESIAGPTIATIPVCFTPQRGQHVFSEL
HRLQAERAAATPFEHFGLANIRRLSNQSEAACQFQSLLLIQQAKIASTDDLFLPVAEKVTAGDFSAFALEICCEL
SRGGCAITLSYDSNVLDGRQAARLLAQFTHTLCQVQAHPDKVLSELNLVTPLTWNTLLEWNRILPSAVNRCIHDG
IKKQCVSAPDAQAVCAWDGNLSYRELHDLSSRLAFHLQSFGLGSESFVPILSENTAISALADHFLKRRC*
Coding >OphauB2|6494
ATGTACTGCACAGGAGATTTTGTTCAGTATGTGGGAGATGGCGTCCTGCGATACATTGGACGCAGAGACTCTCAG
GAAAAAATCAATGGCCAGCGACTGGAACTGCGTGATGTGGAGCATGGCTTGAACCAGGTGCTACCTGAGCCTTGT
CGGCCCCTAGCTGCTATAATCAGGCCAGTGGACGACTCGCCACCCATTTTGGCTGGATTTGTGCAACTTCCTGGC
ATTGAGGATTCTACAAATGGCAGGACAGAGCCTCTGCACGGTATTTTTGCTTACCCCAGCCAATACTTTCGCCAG
ATGGCAGAGCGGGCTACGGTAGAACTGGCTAGCCGGCTGCCGCGCTACATGATTCCTGCCGTCATGATTCAGTTG
ACTGTGATTCCAACAACACCAACTGGCAAGTCCAACAGACGAGAGGTGGCAAGGTTGGCGTCAAAGCTCACAAAG
AGGGAGCTTGATGGCTTCATGAGAGGCTCAGGCGAGCAGATGGCTCCAGAAACGGACATGGAGAAGCAGCTTTAC
CGACTGGTGGAACAAGTGTTGCATGTTGATGATTTTGGAATGAATGACAGCTTCTTTAGGCTAGGAGGGGATTCC
ATCAAGGCTATGCAGCTGGTGCGCCAGGCGAGGGAGCTTGCCGGACTAGAGTTTACTTTGGACAACATGTTCAAG
TGTCCTGTGCTCTCCGACTTGGCTCTGACAATGCGTCCCTATCGGGAGCAGGTGGACGTGGCGCCATTTTCTCTC
CTTGCCGGCTCGAGCTCGGTGCATGAAATTTTGGTAATGGCCCGAAACATGTGTCGTCTGTCGTCTGTTGATGAG
ATTGATGATGTGTATCCCTGCACCCAGCTGCAAGAGGGCATCATGGCGCTTTCCATGTCGAGCACACAAGCGAAA
TATGTGACCACGTCGACCTATACTCTGCCGCGGGCCATTGAGCTTGACAGACTAAAGGCTGCGTGGGACATGGTG
ATTACAAAAACGGCCATTTTGCGGACTCGCATCATCCAGGGACCGTTTGAGCAGGCGTTGCAAGTCGTTCTCAAA
CAGGGTGTTGAGTGGCAGCAAGCAACTGATATGGAGCATCTTAAACGCCAGCGCGAGCAATGGCGTGTCGAGTTG
GGAGGGCCGCTGTTTCGACTCGTTTTGCTGCAGTCATCTGGCCAACTCCATCTCGCCGTCTTCATCTCCCATGCA
ATTTACGACGGCTGGTCGCTCCCCGAGACGCTGGCGCAGGTCGAGACAGCATACCGAGGGGAGAATGTAGATTCC
AAGCCCTTTTCGCACTTTATTCAACACACTCAATCGCTAGACATGGCCTTGGCCAAGACGTTTTGGGAGACACAT
CTAGCTGGCTTTTCGGAGCAGTCTTTTCCAAGAGCGCCAGCCAACTACCGCGCAGCCTCAACTGCAACGCTGAAG
CGCTCGCTGTGTCTCAAAGAGTCAAAGACTGCCTTGGATTCTTCGCTGCCGAGGCTCGTCTCCCTTGCTTGGGCC
ATGACGGTCTCTCAATATACCGGCTCTGATGATGTGTGTTTTGGCATGACTCTGGCAGGACGCAACGTGCCGGTG
CCAGACATTGATCGGATACTCGCGCCGACTATTACCACGATTCCCCTCAGGGTCCGTCTCGACACATCTCATACG
GTTCAGCACACGCTCTCCCTGCTGCAAAAGCAGTTTATAGACACCATGCCGTTTGAGCATACAGGCCTTCAGCGA
ATTGCTACTTTTGGGCCCGGTGCTGCTGCCGCCTGTCGTTTCCAGAATCATGTCGTCATTCAACCCCCTCGAGCC
GATTCGACATCAGAAATCTTTGCTGACGAAGACAAGAAAGAGGTGGACGATAACTACATTCTTTCCATCGCAGTT
ACCCTTCCCGCTGCTGAATCCACCACGTTACATGTCGAGGCTGTCTACCATGATCAAATAGTCTCTGAATGGCTG
GCGAATAAAATGGCGGACCAGCTTTGCCACAATATCTTGCACATGGCGATGAATCAATCCACAACGCTTGGCAAT
TTAACTTCGATGCCCGATACAGGCCTCGCTACCATTATGAACTGGAATGGCCAACTTCCAGTGGCTGTTGACAGC
TGTGTTCACGATCTTGTCGGCCAGCACTGTGTGTGCCAGCCCGATGCCATAGCAGTCGACGCCCATGACGGCAGC
TTATCCTATCGAGACCTTGACACACGTGCAACAAAGCTAGCTGCACATCTTCAAGCTCTTGGCGTTGGGCCCGGT
GCTTACATCTTGGTCATGATGGAGCGTTCTCTTTGGGCCGTGATTGCAATAATGGGCATCATCAAGGCTGGTGCA
GCTTTTGTCATTATGGATCCATCGATACCAGACTTTCGCTTGCGTCAGATACGGCAAAATACCGAGGCAGGAATA
GTCTTGGCATCAATGAAGCATGCGACAAGAGTGCTGGAGCTGGGCCTACAGGCTGTAATTGTCAATTGTGAACAA
GGCTGGCTCAAGAGTCTGGCTCATTTCACAACACCAACCGTCTCTCCCGACGACGCCGTCTACGTTGTCTACACT
TCTGGCTCGACGGGTCAGCCAAAAGGAGTAGTGATTCAGCAACGTGCCTTGGCCACTGCTGCTACAATCAATGGT
GCCCATTTCAAAATCGACAAGACCACTCGGTTGCTCCACGTGGCTTCTTTTGCATTCGATGCCTCCATCGCAGAG
ATTTTCTATGCCCTAGTTCACGGTGGATGTGTATGCATCCCATCGGAAGCGGAGAGCCGCAATAGCCTGGAAGAC
GCCATGAATCGATTCCAAGTCAGCTGGGCTACCTTGACCCCGTCTCTGGCCAGAGCCATGAGCCCTTCCAAGCTC
AATACCTTGCAAGTATTGGCAGTTGGCGGCGAGGCTCTGACCAAGGCGGATATTATCATGTGGGCAGACAGAATC
CACTTGATGAATGGGTACGGTCCGGCAGAGGCCACTATCGACTCAACCATTCAACAACATGTCAGCCTTGGCAAA
TCTCACTCAAACATTGGGCACGGAGCGGCAACTAGAACCTGGATTATGGCCGCTCAAGACGCCACATGCAGCAAG
CTCATGCCACTCGGGGCTGTTGGAGAGCTTGTCCTCGAAGGACCTGTCCTTGCCAAGGGCTATCTCAAAGACACC
GCCAAGACTACCTCCTCCTTTATGGAGTATCCAGACTGGCTCAGGCAGCTGCGGCATGGAAAGAATGGCCGGCTC
TATAAAACGGGAGACTTGGTTCAGTACAGTCCCAGCGGCGACGGGTCTCTGCTTTACATGGGCCGCAAGGATAAC
CAAGTGAAGCTAAGAGGGCAGAGACTTGAGCTCGGCGAGGTGGAGCAGCATTTACTTGAGTGCCTGCCCGCGGCT
GAGCAAGTCATTGCGGAAGTGGTCGAGCCACGGGATGCCGAGCCCGCGCTGGCGGCCTATTGTTTCTTTAGGAGA
GATAACGAGACGACTTGTGAGACGCGTGTTCTGGGCCCGATGGAGTCTGCAATGAGTGCGCAATTCAATGACGCC
GAAACTCGAATGCTTTGCAGAGTGCCAGGCTACATGGTTCCGACCCTGTTTTTGCCGCTAGCACGAGTTCCTCTC
TCGACTACAGGAAAGGCGGACAGGCGACTGTTGCGAGAATTAGCCTCGTCCATGTCGACAAGGGAGCTCAAGATG
TACAGTAAAACGGCGGTGCAGAAGCGTCCTCCGTCATCCAGCAAGGAGCGCATTATCCAACGCAAGGCCAGCGAC
GTTCTTCGACTGGTCCTGGATGAGGTTGGAATGAATGACAACTTTTTCCAACTCGGTGGAGATTCAATTGCAGCA
ATGAAGCTGGCTGGGGCTGTTAGGGATAGTGGGTTTCATGTCACAGTCGCCGACATTTTTAGCCATCCTCGTCTA
GGAGACCTGGCGGCCAGATTGGAAAAGAGCGATGCCGGCAGCGCCCCGAAAATTGCACCCTTTGAGCTACTGCCC
GAGACAAAGCGGCCCAGCATAATGCAAGCCGCTGCCAGTCAGTGCCAAGTTGACGTGAATACGATTCAAGACTTG
TATCCTTGCACGCCTATGCAGGAAGCACTCCTGGCACTGGCCATGAAGCAGAGCGGCCAATACGTCGCCGAGCTG
ACCTTTGACCTTGGCCATGACGTCGACGTTGATCGAGTAAAGGCTGCCTGGGAAGCTGTATACGCTGCAAGCTCG
ATCCTAAGGACGCGCATCATCCCGCCCTTGACAAGTTTGGATTCTTCGCTCCAAGTCGTCATCAAGGAGCCGCTG
TTCTGGTCGTCAGACTCGCATCCTTTGGAGGCTGAGAATGGGAAGGCGCTGCACAAGGCTGCCATTTATCATGAA
GCGGGACAGGGGAAACTGCGAATATGGCTCCATCATGCGCTTTATGATGGAACATCTCTGCCTCTGCTTCTTGAA
CAAGCAGAGGCAGCTTACAACGGATGCTCGCCATTGTCCAAACCATTTAATATATTTGCCGCTTATACTCAGACG
CTCAATGGTGAAGAAGGCAGACAGTTTTGGGAGGGTGAGATGAAGGGCTTAAACACCACCATGTTTCCGCTGCTG
CGAAGCCCACACTTGTCGGGAAAACGAGAGTTTGTGTCGTGCGACATTTCGATCCCCAACGTCAAAGGCAGCGAG
TTTACACTGCCGTCCTTGATTCACTCAGTCTGCGCCGCCAGTCTCGGACACTTTGCAAATACTGACGACGTGGTG
TATGGGATCACGCTGGCGGGCAGAGATGCTCCTGTTGACGGAATCGAGAGCCTGATTGGTCCAACCATGACAACG
GTGCCGTTTCGAGTGCAGCCATGGCCCAAGTGGTCGATGCAAGAGTTGATGCTTGATATCCAAGACCGTTTGGCC
AGACTCATGCCCTTTGAGCACACGGGCCTTCAAGCAATAAGGCAGTTTAGTGCCGAGTGCGCTGTAGCGTGCGAC
TTTGACTGCCACGTGGTGATTCAGCCGGCCGATGAAGGGACGGAAAACAAGGTGTTCAAGGAAACTGCTAGGAGC
GACGACGTCTACTCCAACTTTTCCAACTCGCCACTCTTGCTCGTCTTTACACTTTCAGCCGATAGACGGTCGGTG
CATCTAGTTGTCAATTTTGATGTCTCCCATCTCGATGCGGTTGAGGCGACAAACTTTGCGCAACATCTGGACCAT
GGCATTCAGCAGGCCATGCTAGATGCGACTTTGCCCGTTGAAAAGATTCAGATGGCAAGCCCGCATCACATGGCC
CTTCTCGAAAATCGCAATGCCCTTGTTCCGCCCAGGCTGGATATGCTGGTGCATGAATTAGTGGCGGAGCAGTGT
CGTCGTCGGCCAAGCGCCCAAGCCGTCGCTTCATGGGACGGATCGCTGACATATGGGCAACTCGACAATTTCAGT
GCCATGTTGGCGCAGCATCTCTTGACACACGGGGCCGGGCCTGGAAAGGTGGCTGCGCTGTGTATGCCAAAGTCG
CAATGGGCCGTTGTGGCCGTCTTGTCTGCTCTCAAGTCGGGCTCAGCGTGCGCCATGATGGATGCATCCCACCCA
AAAGGGCGCATGCAGGAAATCGTCAACCAGACCAGCGCCGCCATTGTTTTGGCGTCGCCAGAGACTCGCGAGACG
GCTCAAGCCATTGCTGCAGGCGCCATGGTGGTTGTGGTGTCGCCTGCTTTGCTTCATGGTTTGCCCGCGCCAGAT
TCCAAGATTTGCTCCGCTGTGACTTGCTCAGACGTTGCTTGCATTTTCTTCACGTCTGGGAGCACGGGAAAGTCC
AAGGGATTCACCTTGGAGCACGCGAGCATCTCGACTGGGCTACGAGATCTCCGAGGCCCGCTTGGCTGGGACCAG
GATTCGCGCATGCTGCACTTTGCTTCGTATGCTTTTGACATGGGCCTTCTTGAGCTTCTAGGGAGCATGGCGGTT
GGGGCGTGTCTATGTATTCCCTCTGACACGGACCGCATGTCGAATCTTTGCGGCTTCATCGAGGCCAAACAGGTC
AACTGGGGCTTCATGATTCCATCCACCTCGCATCTCCTAGATGCTCTCAGCGTTCCATCACTCAAGACACTAGTC
ATGGGCGGCGAGGCCCCCAAGCTGGCTGATATCCAGCGCTGGGCCGCGAGAAAAGACGTGCGCCTCCTAAATTTA
TATGGCCCGGCTGAGTGCATGGTTGGAGTGACTTGCGGCCTCATGTCGCCAACAGAATGGATACATGGTCTCAGT
GGCCATGTTGTCAATGGTGTCGGTTGGATTGCAAGTCCTCGCGACCCTAGCCAACTCTGTGCTGTTGGGGCCATG
GGCGAGTTGCTGGTTGAGGGTGCTCATCTCGCACGGGAGTATCTTGGCGATGCAGAAAAGACCAGCGCCAGTTTT
ATTCCCAGCCCGCCCTGGCTTACTCGCTTCCGCGGGCACGATGGAAACCGTCTTTACCGAACCGGTGATCTCTTT
CAGCTCATGAGCAACGGCTCCGTCAGATTCATTGGCCGCAAGGACCGGCAGGTAAAGCTAAATGGCCAACGCATC
GAGCCGCAAGAGGTTGAAAGTAATCTCATGGCGCTTTTCCCACAAGACACCATGGTCATTGTCGATGTCGTTGTG
CAGAAGTCGCCAGCGCCTCGACAGCGACTTGTTGCTTTTATCCATGTTGCAGACGGCAAGCCCAAGCCTTGTTTC
TCTTCGCATCAAGATTCATTATTCGCCAGCCCAGACATTGACCTGTTGAAGCTTTGTCGCGCTGCCAAGCAAAAG
ATTAGCGAGTCGCTGCCGCGCTACATGATACCCGAGACATTTATCCCCTTGACCCGTGTGCCCCGAACAGTTAGC
GGCAAGATTAATCGCGGCTTGCTCTGCGATGCAGCCAGTACGCTACAGGGCCCCGACTTGGATCGTCTATCGGGC
CTTGCAACTATAGAGTCTCGGCCACTTGACAAGTTGGAGACGGACATGGCTGTGCTGTGGACAGACGTCTTGGGC
TTGCAGCTAGACGCCGTGAGCGCAAACGAAAACTTTTTCCACGTTGGAGGCGACTCCATCACAGCCATGAAACTT
GTCGGAGCCGCTCGTTCACAGGGGATTTCCATGACTGTGCCGCAAATATTTGCTCATCCGCGTCTGGCCGACTTG
GTCAGAGTTGCCAAGTTTGACAGCAAGGTAAATGGAGTGGAAGCTGCCATTGAGCCATTTTCTCTACTTGCAGAG
CATGAGAGAGAAGTGGTGCTCAAGACAGCCGAGCGGCAATGTTTGCTTCCAAGAACGCAGATTGAGGACATTTAT
CCTTGCACGCCGCTGCAAGAGGCTCTTGTTTCGCAGTCGATGCGCTCTTCAAGTGCCTACATGGGACGCTTTAGA
TACAAACTCGGCTCGCAAGTCGATGTGTCTCGATTTACACAGGCATGGAGCCATGTTGTCAGAGCAAATCCCATC
TTGCGCACCAGAATGATTCAGACTTTAGCCATGTACCAAGTGGTGCTGCTGGAAGAGGCAACCTTTGAAACCGTC
GACTCGGACTCGCTGGACGGCTTTGAGTCGCAGCTACAAAAAGACGGGATTCAAATGGGCTGTCCACTCCTGCAA
CTCGTCCTCAGCCAGCCCAAGACTTGTGGGGTTGATGTGGAATTTTGCCTCCTTCTTCATCATGCCTTGTATGAT
GCATGGTCCATTGACTTGATATTGGGCCAGGTGCGCCAAGCTTATGCCGGCAAGACGCCCGTCTGTCAGCCTTTT
AACCGCTTTATTGACTATACTGTTAGACAGAAGCAAGACGCCATGGAAAGCTACTGGCTCAAGCAGCTGTCTGAT
GCGAGTCAAGTCGTGTTCCCAGCACTGCCTAGAAGCGACTACAAGCCCTTTACTGATTCAGACATTCGACAAGAG
GTCCAAGTCGTGCCTGTTTTGGGCATTACTTTTGCAACGTTGCTCGAGTTTTCCTGGGCGGCTACACTTTCTCAG
TACTGCGACTCTGGAGGAGTTACGCATGGGCTCGTTCTCTCGGGGCGCAACGCCAATGTTGCAGGCATTGAATCC
ATTGCCGGGCCAACCATTGCCACCATTCCCGTTTGTTTCACGCCTCAACGAGGCCAACACGTCTTTTCTGAGCTG
CATAGGCTGCAGGCCGAGAGAGCGGCAGCTACGCCGTTTGAGCATTTCGGCCTGGCAAACATTCGCCGGCTGAGC
AACCAGTCGGAAGCGGCGTGCCAGTTTCAAAGCCTCTTGCTCATTCAGCAAGCCAAAATCGCCTCGACCGACGAC
CTTTTCCTGCCCGTTGCTGAAAAGGTGACTGCTGGAGATTTTAGCGCCTTTGCACTCGAGATTTGCTGTGAGCTT
TCTAGAGGCGGATGCGCAATTACCTTGAGCTACGACTCCAACGTGCTGGACGGGCGGCAGGCTGCAAGGTTGTTG
GCACAGTTTACGCACACGCTCTGTCAAGTACAAGCTCATCCCGACAAGGTGCTGTCGGAACTGAATCTTGTCACT
CCATTAACCTGGAACACGTTGTTGGAATGGAACAGGATTCTTCCCAGTGCTGTCAACCGCTGCATTCATGATGGT
ATCAAGAAGCAATGCGTCAGTGCTCCAGACGCCCAAGCGGTGTGTGCATGGGACGGCAACTTGTCATACCGCGAG
CTGCATGACTTGTCCTCGAGGCTCGCTTTTCATCTACAGAGCTTTGGTCTCGGCTCCGAATCGTTTGTTCCCATC
TTGTCCGAAAATACTGCCATTTCAGCGCTTGCAGACCATTTTCTCAAGCGTCGATGCTAG
Transcript >OphauB2|6494
ATGTACTGCACAGGAGATTTTGTTCAGTATGTGGGAGATGGCGTCCTGCGATACATTGGACGCAGAGACTCTCAG
GAAAAAATCAATGGCCAGCGACTGGAACTGCGTGATGTGGAGCATGGCTTGAACCAGGTGCTACCTGAGCCTTGT
CGGCCCCTAGCTGCTATAATCAGGCCAGTGGACGACTCGCCACCCATTTTGGCTGGATTTGTGCAACTTCCTGGC
ATTGAGGATTCTACAAATGGCAGGACAGAGCCTCTGCACGGTATTTTTGCTTACCCCAGCCAATACTTTCGCCAG
ATGGCAGAGCGGGCTACGGTAGAACTGGCTAGCCGGCTGCCGCGCTACATGATTCCTGCCGTCATGATTCAGTTG
ACTGTGATTCCAACAACACCAACTGGCAAGTCCAACAGACGAGAGGTGGCAAGGTTGGCGTCAAAGCTCACAAAG
AGGGAGCTTGATGGCTTCATGAGAGGCTCAGGCGAGCAGATGGCTCCAGAAACGGACATGGAGAAGCAGCTTTAC
CGACTGGTGGAACAAGTGTTGCATGTTGATGATTTTGGAATGAATGACAGCTTCTTTAGGCTAGGAGGGGATTCC
ATCAAGGCTATGCAGCTGGTGCGCCAGGCGAGGGAGCTTGCCGGACTAGAGTTTACTTTGGACAACATGTTCAAG
TGTCCTGTGCTCTCCGACTTGGCTCTGACAATGCGTCCCTATCGGGAGCAGGTGGACGTGGCGCCATTTTCTCTC
CTTGCCGGCTCGAGCTCGGTGCATGAAATTTTGGTAATGGCCCGAAACATGTGTCGTCTGTCGTCTGTTGATGAG
ATTGATGATGTGTATCCCTGCACCCAGCTGCAAGAGGGCATCATGGCGCTTTCCATGTCGAGCACACAAGCGAAA
TATGTGACCACGTCGACCTATACTCTGCCGCGGGCCATTGAGCTTGACAGACTAAAGGCTGCGTGGGACATGGTG
ATTACAAAAACGGCCATTTTGCGGACTCGCATCATCCAGGGACCGTTTGAGCAGGCGTTGCAAGTCGTTCTCAAA
CAGGGTGTTGAGTGGCAGCAAGCAACTGATATGGAGCATCTTAAACGCCAGCGCGAGCAATGGCGTGTCGAGTTG
GGAGGGCCGCTGTTTCGACTCGTTTTGCTGCAGTCATCTGGCCAACTCCATCTCGCCGTCTTCATCTCCCATGCA
ATTTACGACGGCTGGTCGCTCCCCGAGACGCTGGCGCAGGTCGAGACAGCATACCGAGGGGAGAATGTAGATTCC
AAGCCCTTTTCGCACTTTATTCAACACACTCAATCGCTAGACATGGCCTTGGCCAAGACGTTTTGGGAGACACAT
CTAGCTGGCTTTTCGGAGCAGTCTTTTCCAAGAGCGCCAGCCAACTACCGCGCAGCCTCAACTGCAACGCTGAAG
CGCTCGCTGTGTCTCAAAGAGTCAAAGACTGCCTTGGATTCTTCGCTGCCGAGGCTCGTCTCCCTTGCTTGGGCC
ATGACGGTCTCTCAATATACCGGCTCTGATGATGTGTGTTTTGGCATGACTCTGGCAGGACGCAACGTGCCGGTG
CCAGACATTGATCGGATACTCGCGCCGACTATTACCACGATTCCCCTCAGGGTCCGTCTCGACACATCTCATACG
GTTCAGCACACGCTCTCCCTGCTGCAAAAGCAGTTTATAGACACCATGCCGTTTGAGCATACAGGCCTTCAGCGA
ATTGCTACTTTTGGGCCCGGTGCTGCTGCCGCCTGTCGTTTCCAGAATCATGTCGTCATTCAACCCCCTCGAGCC
GATTCGACATCAGAAATCTTTGCTGACGAAGACAAGAAAGAGGTGGACGATAACTACATTCTTTCCATCGCAGTT
ACCCTTCCCGCTGCTGAATCCACCACGTTACATGTCGAGGCTGTCTACCATGATCAAATAGTCTCTGAATGGCTG
GCGAATAAAATGGCGGACCAGCTTTGCCACAATATCTTGCACATGGCGATGAATCAATCCACAACGCTTGGCAAT
TTAACTTCGATGCCCGATACAGGCCTCGCTACCATTATGAACTGGAATGGCCAACTTCCAGTGGCTGTTGACAGC
TGTGTTCACGATCTTGTCGGCCAGCACTGTGTGTGCCAGCCCGATGCCATAGCAGTCGACGCCCATGACGGCAGC
TTATCCTATCGAGACCTTGACACACGTGCAACAAAGCTAGCTGCACATCTTCAAGCTCTTGGCGTTGGGCCCGGT
GCTTACATCTTGGTCATGATGGAGCGTTCTCTTTGGGCCGTGATTGCAATAATGGGCATCATCAAGGCTGGTGCA
GCTTTTGTCATTATGGATCCATCGATACCAGACTTTCGCTTGCGTCAGATACGGCAAAATACCGAGGCAGGAATA
GTCTTGGCATCAATGAAGCATGCGACAAGAGTGCTGGAGCTGGGCCTACAGGCTGTAATTGTCAATTGTGAACAA
GGCTGGCTCAAGAGTCTGGCTCATTTCACAACACCAACCGTCTCTCCCGACGACGCCGTCTACGTTGTCTACACT
TCTGGCTCGACGGGTCAGCCAAAAGGAGTAGTGATTCAGCAACGTGCCTTGGCCACTGCTGCTACAATCAATGGT
GCCCATTTCAAAATCGACAAGACCACTCGGTTGCTCCACGTGGCTTCTTTTGCATTCGATGCCTCCATCGCAGAG
ATTTTCTATGCCCTAGTTCACGGTGGATGTGTATGCATCCCATCGGAAGCGGAGAGCCGCAATAGCCTGGAAGAC
GCCATGAATCGATTCCAAGTCAGCTGGGCTACCTTGACCCCGTCTCTGGCCAGAGCCATGAGCCCTTCCAAGCTC
AATACCTTGCAAGTATTGGCAGTTGGCGGCGAGGCTCTGACCAAGGCGGATATTATCATGTGGGCAGACAGAATC
CACTTGATGAATGGGTACGGTCCGGCAGAGGCCACTATCGACTCAACCATTCAACAACATGTCAGCCTTGGCAAA
TCTCACTCAAACATTGGGCACGGAGCGGCAACTAGAACCTGGATTATGGCCGCTCAAGACGCCACATGCAGCAAG
CTCATGCCACTCGGGGCTGTTGGAGAGCTTGTCCTCGAAGGACCTGTCCTTGCCAAGGGCTATCTCAAAGACACC
GCCAAGACTACCTCCTCCTTTATGGAGTATCCAGACTGGCTCAGGCAGCTGCGGCATGGAAAGAATGGCCGGCTC
TATAAAACGGGAGACTTGGTTCAGTACAGTCCCAGCGGCGACGGGTCTCTGCTTTACATGGGCCGCAAGGATAAC
CAAGTGAAGCTAAGAGGGCAGAGACTTGAGCTCGGCGAGGTGGAGCAGCATTTACTTGAGTGCCTGCCCGCGGCT
GAGCAAGTCATTGCGGAAGTGGTCGAGCCACGGGATGCCGAGCCCGCGCTGGCGGCCTATTGTTTCTTTAGGAGA
GATAACGAGACGACTTGTGAGACGCGTGTTCTGGGCCCGATGGAGTCTGCAATGAGTGCGCAATTCAATGACGCC
GAAACTCGAATGCTTTGCAGAGTGCCAGGCTACATGGTTCCGACCCTGTTTTTGCCGCTAGCACGAGTTCCTCTC
TCGACTACAGGAAAGGCGGACAGGCGACTGTTGCGAGAATTAGCCTCGTCCATGTCGACAAGGGAGCTCAAGATG
TACAGTAAAACGGCGGTGCAGAAGCGTCCTCCGTCATCCAGCAAGGAGCGCATTATCCAACGCAAGGCCAGCGAC
GTTCTTCGACTGGTCCTGGATGAGGTTGGAATGAATGACAACTTTTTCCAACTCGGTGGAGATTCAATTGCAGCA
ATGAAGCTGGCTGGGGCTGTTAGGGATAGTGGGTTTCATGTCACAGTCGCCGACATTTTTAGCCATCCTCGTCTA
GGAGACCTGGCGGCCAGATTGGAAAAGAGCGATGCCGGCAGCGCCCCGAAAATTGCACCCTTTGAGCTACTGCCC
GAGACAAAGCGGCCCAGCATAATGCAAGCCGCTGCCAGTCAGTGCCAAGTTGACGTGAATACGATTCAAGACTTG
TATCCTTGCACGCCTATGCAGGAAGCACTCCTGGCACTGGCCATGAAGCAGAGCGGCCAATACGTCGCCGAGCTG
ACCTTTGACCTTGGCCATGACGTCGACGTTGATCGAGTAAAGGCTGCCTGGGAAGCTGTATACGCTGCAAGCTCG
ATCCTAAGGACGCGCATCATCCCGCCCTTGACAAGTTTGGATTCTTCGCTCCAAGTCGTCATCAAGGAGCCGCTG
TTCTGGTCGTCAGACTCGCATCCTTTGGAGGCTGAGAATGGGAAGGCGCTGCACAAGGCTGCCATTTATCATGAA
GCGGGACAGGGGAAACTGCGAATATGGCTCCATCATGCGCTTTATGATGGAACATCTCTGCCTCTGCTTCTTGAA
CAAGCAGAGGCAGCTTACAACGGATGCTCGCCATTGTCCAAACCATTTAATATATTTGCCGCTTATACTCAGACG
CTCAATGGTGAAGAAGGCAGACAGTTTTGGGAGGGTGAGATGAAGGGCTTAAACACCACCATGTTTCCGCTGCTG
CGAAGCCCACACTTGTCGGGAAAACGAGAGTTTGTGTCGTGCGACATTTCGATCCCCAACGTCAAAGGCAGCGAG
TTTACACTGCCGTCCTTGATTCACTCAGTCTGCGCCGCCAGTCTCGGACACTTTGCAAATACTGACGACGTGGTG
TATGGGATCACGCTGGCGGGCAGAGATGCTCCTGTTGACGGAATCGAGAGCCTGATTGGTCCAACCATGACAACG
GTGCCGTTTCGAGTGCAGCCATGGCCCAAGTGGTCGATGCAAGAGTTGATGCTTGATATCCAAGACCGTTTGGCC
AGACTCATGCCCTTTGAGCACACGGGCCTTCAAGCAATAAGGCAGTTTAGTGCCGAGTGCGCTGTAGCGTGCGAC
TTTGACTGCCACGTGGTGATTCAGCCGGCCGATGAAGGGACGGAAAACAAGGTGTTCAAGGAAACTGCTAGGAGC
GACGACGTCTACTCCAACTTTTCCAACTCGCCACTCTTGCTCGTCTTTACACTTTCAGCCGATAGACGGTCGGTG
CATCTAGTTGTCAATTTTGATGTCTCCCATCTCGATGCGGTTGAGGCGACAAACTTTGCGCAACATCTGGACCAT
GGCATTCAGCAGGCCATGCTAGATGCGACTTTGCCCGTTGAAAAGATTCAGATGGCAAGCCCGCATCACATGGCC
CTTCTCGAAAATCGCAATGCCCTTGTTCCGCCCAGGCTGGATATGCTGGTGCATGAATTAGTGGCGGAGCAGTGT
CGTCGTCGGCCAAGCGCCCAAGCCGTCGCTTCATGGGACGGATCGCTGACATATGGGCAACTCGACAATTTCAGT
GCCATGTTGGCGCAGCATCTCTTGACACACGGGGCCGGGCCTGGAAAGGTGGCTGCGCTGTGTATGCCAAAGTCG
CAATGGGCCGTTGTGGCCGTCTTGTCTGCTCTCAAGTCGGGCTCAGCGTGCGCCATGATGGATGCATCCCACCCA
AAAGGGCGCATGCAGGAAATCGTCAACCAGACCAGCGCCGCCATTGTTTTGGCGTCGCCAGAGACTCGCGAGACG
GCTCAAGCCATTGCTGCAGGCGCCATGGTGGTTGTGGTGTCGCCTGCTTTGCTTCATGGTTTGCCCGCGCCAGAT
TCCAAGATTTGCTCCGCTGTGACTTGCTCAGACGTTGCTTGCATTTTCTTCACGTCTGGGAGCACGGGAAAGTCC
AAGGGATTCACCTTGGAGCACGCGAGCATCTCGACTGGGCTACGAGATCTCCGAGGCCCGCTTGGCTGGGACCAG
GATTCGCGCATGCTGCACTTTGCTTCGTATGCTTTTGACATGGGCCTTCTTGAGCTTCTAGGGAGCATGGCGGTT
GGGGCGTGTCTATGTATTCCCTCTGACACGGACCGCATGTCGAATCTTTGCGGCTTCATCGAGGCCAAACAGGTC
AACTGGGGCTTCATGATTCCATCCACCTCGCATCTCCTAGATGCTCTCAGCGTTCCATCACTCAAGACACTAGTC
ATGGGCGGCGAGGCCCCCAAGCTGGCTGATATCCAGCGCTGGGCCGCGAGAAAAGACGTGCGCCTCCTAAATTTA
TATGGCCCGGCTGAGTGCATGGTTGGAGTGACTTGCGGCCTCATGTCGCCAACAGAATGGATACATGGTCTCAGT
GGCCATGTTGTCAATGGTGTCGGTTGGATTGCAAGTCCTCGCGACCCTAGCCAACTCTGTGCTGTTGGGGCCATG
GGCGAGTTGCTGGTTGAGGGTGCTCATCTCGCACGGGAGTATCTTGGCGATGCAGAAAAGACCAGCGCCAGTTTT
ATTCCCAGCCCGCCCTGGCTTACTCGCTTCCGCGGGCACGATGGAAACCGTCTTTACCGAACCGGTGATCTCTTT
CAGCTCATGAGCAACGGCTCCGTCAGATTCATTGGCCGCAAGGACCGGCAGGTAAAGCTAAATGGCCAACGCATC
GAGCCGCAAGAGGTTGAAAGTAATCTCATGGCGCTTTTCCCACAAGACACCATGGTCATTGTCGATGTCGTTGTG
CAGAAGTCGCCAGCGCCTCGACAGCGACTTGTTGCTTTTATCCATGTTGCAGACGGCAAGCCCAAGCCTTGTTTC
TCTTCGCATCAAGATTCATTATTCGCCAGCCCAGACATTGACCTGTTGAAGCTTTGTCGCGCTGCCAAGCAAAAG
ATTAGCGAGTCGCTGCCGCGCTACATGATACCCGAGACATTTATCCCCTTGACCCGTGTGCCCCGAACAGTTAGC
GGCAAGATTAATCGCGGCTTGCTCTGCGATGCAGCCAGTACGCTACAGGGCCCCGACTTGGATCGTCTATCGGGC
CTTGCAACTATAGAGTCTCGGCCACTTGACAAGTTGGAGACGGACATGGCTGTGCTGTGGACAGACGTCTTGGGC
TTGCAGCTAGACGCCGTGAGCGCAAACGAAAACTTTTTCCACGTTGGAGGCGACTCCATCACAGCCATGAAACTT
GTCGGAGCCGCTCGTTCACAGGGGATTTCCATGACTGTGCCGCAAATATTTGCTCATCCGCGTCTGGCCGACTTG
GTCAGAGTTGCCAAGTTTGACAGCAAGGTAAATGGAGTGGAAGCTGCCATTGAGCCATTTTCTCTACTTGCAGAG
CATGAGAGAGAAGTGGTGCTCAAGACAGCCGAGCGGCAATGTTTGCTTCCAAGAACGCAGATTGAGGACATTTAT
CCTTGCACGCCGCTGCAAGAGGCTCTTGTTTCGCAGTCGATGCGCTCTTCAAGTGCCTACATGGGACGCTTTAGA
TACAAACTCGGCTCGCAAGTCGATGTGTCTCGATTTACACAGGCATGGAGCCATGTTGTCAGAGCAAATCCCATC
TTGCGCACCAGAATGATTCAGACTTTAGCCATGTACCAAGTGGTGCTGCTGGAAGAGGCAACCTTTGAAACCGTC
GACTCGGACTCGCTGGACGGCTTTGAGTCGCAGCTACAAAAAGACGGGATTCAAATGGGCTGTCCACTCCTGCAA
CTCGTCCTCAGCCAGCCCAAGACTTGTGGGGTTGATGTGGAATTTTGCCTCCTTCTTCATCATGCCTTGTATGAT
GCATGGTCCATTGACTTGATATTGGGCCAGGTGCGCCAAGCTTATGCCGGCAAGACGCCCGTCTGTCAGCCTTTT
AACCGCTTTATTGACTATACTGTTAGACAGAAGCAAGACGCCATGGAAAGCTACTGGCTCAAGCAGCTGTCTGAT
GCGAGTCAAGTCGTGTTCCCAGCACTGCCTAGAAGCGACTACAAGCCCTTTACTGATTCAGACATTCGACAAGAG
GTCCAAGTCGTGCCTGTTTTGGGCATTACTTTTGCAACGTTGCTCGAGTTTTCCTGGGCGGCTACACTTTCTCAG
TACTGCGACTCTGGAGGAGTTACGCATGGGCTCGTTCTCTCGGGGCGCAACGCCAATGTTGCAGGCATTGAATCC
ATTGCCGGGCCAACCATTGCCACCATTCCCGTTTGTTTCACGCCTCAACGAGGCCAACACGTCTTTTCTGAGCTG
CATAGGCTGCAGGCCGAGAGAGCGGCAGCTACGCCGTTTGAGCATTTCGGCCTGGCAAACATTCGCCGGCTGAGC
AACCAGTCGGAAGCGGCGTGCCAGTTTCAAAGCCTCTTGCTCATTCAGCAAGCCAAAATCGCCTCGACCGACGAC
CTTTTCCTGCCCGTTGCTGAAAAGGTGACTGCTGGAGATTTTAGCGCCTTTGCACTCGAGATTTGCTGTGAGCTT
TCTAGAGGCGGATGCGCAATTACCTTGAGCTACGACTCCAACGTGCTGGACGGGCGGCAGGCTGCAAGGTTGTTG
GCACAGTTTACGCACACGCTCTGTCAAGTACAAGCTCATCCCGACAAGGTGCTGTCGGAACTGAATCTTGTCACT
CCATTAACCTGGAACACGTTGTTGGAATGGAACAGGATTCTTCCCAGTGCTGTCAACCGCTGCATTCATGATGGT
ATCAAGAAGCAATGCGTCAGTGCTCCAGACGCCCAAGCGGTGTGTGCATGGGACGGCAACTTGTCATACCGCGAG
CTGCATGACTTGTCCTCGAGGCTCGCTTTTCATCTACAGAGCTTTGGTCTCGGCTCCGAATCGTTTGTTCCCATC
TTGTCCGAAAATACTGCCATTTCAGCGCTTGCAGACCATTTTCTCAAGCGTCGATGCTAG
Gene >OphauB2|6494
ATGTACTGCACAGGAGATTTTGTTCAGTATGTGGGAGATGGCGTCCTGCGATACATTGGACGCAGAGACTCTCAG
GAAAAAATCAATGGCCAGCGACTGGAACTGCGTGATGTGGAGCATGGCTTGAACCAGGTGCTACCTGAGCCTTGT
CGGCCCCTAGCTGCTATAATCAGGCCAGTGGACGACTCGCCACCCATTTTGGCTGGATTTGTGCAACTTCCTGGC
ATTGAGGATTCTACAAATGGCAGGACAGAGCCTCTGCACGGTATTTTTGCTTACCCCAGCCAATACTTTCGCCAG
ATGGCAGAGCGGGCTACGGTAGAACTGGCTAGCCGGCTGCCGCGCTACATGATTCCTGCCGTCATGATTCAGTTG
ACTGTGATTCCAACAACACCAACTGGCAAGTCCAACAGACGAGAGGTGGCAAGGTTGGCGTCAAAGCTCACAAAG
AGGGAGCTTGATGGCTTCATGAGAGGCTCAGGCGAGCAGATGGCTCCAGAAACGGACATGGAGAAGCAGCTTTAC
CGACTGGTGGAACAAGTGTTGCATGTTGATGATTTTGGAATGAATGACAGCTTCTTTAGGCTAGGAGGGGATTCC
ATCAAGGCTATGCAGCTGGTGCGCCAGGCGAGGGAGCTTGCCGGACTAGAGTTTACTTTGGACAACATGTTCAAG
TGTCCTGTGCTCTCCGACTTGGCTCTGACAATGCGTCCCTATCGGGAGCAGGTGGACGTGGCGCCATTTTCTCTC
CTTGCCGGCTCGAGCTCGGTGCATGAAATTTTGGTAATGGCCCGAAACATGTGTCGTCTGTCGTCTGTTGATGAG
ATTGATGATGTGTATCCCTGCACCCAGCTGCAAGAGGGCATCATGGCGCTTTCCATGTCGAGCACACAAGCGAAA
TATGTGACCACGTCGACCTATACTCTGCCGCGGGCCATTGAGCTTGACAGACTAAAGGCTGCGTGGGACATGGTG
ATTACAAAAACGGCCATTTTGCGGACTCGCATCATCCAGGGACCGTTTGAGCAGGCGTTGCAAGTCGTTCTCAAA
CAGGGTGTTGAGTGGCAGCAAGCAACTGATATGGAGCATCTTAAACGCCAGCGCGAGCAATGGCGTGTCGAGTTG
GGAGGGCCGCTGTTTCGACTCGTTTTGCTGCAGTCATCTGGCCAACTCCATCTCGCCGTCTTCATCTCCCATGCA
ATTTACGACGGCTGGTCGCTCCCCGAGACGCTGGCGCAGGTCGAGACAGCATACCGAGGGGAGAATGTAGATTCC
AAGCCCTTTTCGCACTTTATTCAACACACTCAATCGCTAGACATGGCCTTGGCCAAGACGTTTTGGGAGACACAT
CTAGCTGGCTTTTCGGAGCAGTCTTTTCCAAGAGCGCCAGCCAACTACCGCGCAGCCTCAACTGCAACGCTGAAG
CGCTCGCTGTGTCTCAAAGAGTCAAAGACTGCCTTGGATTCTTCGCTGCCGAGGCTCGTCTCCCTTGCTTGGGCC
ATGACGGTCTCTCAATATACCGGCTCTGATGATGTGTGTTTTGGCATGACTCTGGCAGGACGCAACGTGCCGGTG
CCAGACATTGATCGGATACTCGCGCCGACTATTACCACGATTCCCCTCAGGGTCCGTCTCGACACATCTCATACG
GTTCAGCACACGCTCTCCCTGCTGCAAAAGCAGTTTATAGACACCATGCCGTTTGAGCATACAGGCCTTCAGCGA
ATTGCTACTTTTGGGCCCGGTGCTGCTGCCGCCTGTCGTTTCCAGAATCATGTCGTCATTCAACCCCCTCGAGCC
GATTCGACATCAGAAATCTTTGCTGACGAAGACAAGAAAGAGGTGGACGATAACTACATTCTTTCCATCGCAGTT
ACCCTTCCCGCTGCTGAATCCACCACGTTACATGTCGAGGCTGTCTACCATGATCAAATAGTCTCTGAATGGCTG
GCGAATAAAATGGCGGACCAGCTTTGCCACAATATCTTGCACATGGCGATGAATCAATCCACAACGCTTGGCAAT
TTAACTTCGATGCCCGATACAGGCCTCGCTACCATTATGAACTGGAATGGCCAACTTCCAGTGGCTGTTGACAGC
TGTGTTCACGATCTTGTCGGCCAGCACTGTGTGTGCCAGCCCGATGCCATAGCAGTCGACGCCCATGACGGCAGC
TTATCCTATCGAGACCTTGACACACGTGCAACAAAGCTAGCTGCACATCTTCAAGCTCTTGGCGTTGGGCCCGGT
GCTTACATCTTGGTCATGATGGAGCGTTCTCTTTGGGCCGTGATTGCAATAATGGGCATCATCAAGGCTGGTGCA
GCTTTTGTCATTATGGATCCATCGATACCAGACTTTCGCTTGCGTCAGATACGGCAAAATACCGAGGCAGGAATA
GTCTTGGCATCAATGAAGCATGCGACAAGAGTGCTGGAGCTGGGCCTACAGGCTGTAATTGTCAATTGTGAACAA
GGCTGGCTCAAGAGTCTGGCTCATTTCACAACACCAACCGTCTCTCCCGACGACGCCGTCTACGTTGTCTACACT
TCTGGCTCGACGGGTCAGCCAAAAGGAGTAGTGATTCAGCAACGTGCCTTGGCCACTGCTGCTACAATCAATGGT
GCCCATTTCAAAATCGACAAGACCACTCGGTTGCTCCACGTGGCTTCTTTTGCATTCGATGCCTCCATCGCAGAG
ATTTTCTATGCCCTAGTTCACGGTGGATGTGTATGCATCCCATCGGAAGCGGAGAGCCGCAATAGCCTGGAAGAC
GCCATGAATCGATTCCAAGTCAGCTGGGCTACCTTGACCCCGTCTCTGGCCAGAGCCATGAGCCCTTCCAAGCTC
AATACCTTGCAAGTATTGGCAGTTGGCGGCGAGGCTCTGACCAAGGCGGATATTATCATGTGGGCAGACAGAATC
CACTTGATGAATGGGTACGGTCCGGCAGAGGCCACTATCGACTCAACCATTCAACAACATGTCAGCCTTGGCAAA
TCTCACTCAAACATTGGGCACGGAGCGGCAACTAGAACCTGGATTATGGCCGCTCAAGACGCCACATGCAGCAAG
CTCATGCCACTCGGGGCTGTTGGAGAGCTTGTCCTCGAAGGACCTGTCCTTGCCAAGGGCTATCTCAAAGACACC
GCCAAGACTACCTCCTCCTTTATGGAGTATCCAGACTGGCTCAGGCAGCTGCGGCATGGAAAGAATGGCCGGCTC
TATAAAACGGGAGACTTGGTTCAGTACAGTCCCAGCGGCGACGGGTCTCTGCTTTACATGGGCCGCAAGGATAAC
CAAGTGAAGCTAAGAGGGCAGAGACTTGAGCTCGGCGAGGTGGAGCAGCATTTACTTGAGTGCCTGCCCGCGGCT
GAGCAAGTCATTGCGGAAGTGGTCGAGCCACGGGATGCCGAGCCCGCGCTGGCGGCCTATTGTTTCTTTAGGAGA
GATAACGAGACGACTTGTGAGACGCGTGTTCTGGGCCCGATGGAGTCTGCAATGAGTGCGCAATTCAATGACGCC
GAAACTCGAATGCTTTGCAGAGTGCCAGGCTACATGGTTCCGACCCTGTTTTTGCCGCTAGCACGAGTTCCTCTC
TCGACTACAGGAAAGGCGGACAGGCGACTGTTGCGAGAATTAGCCTCGTCCATGTCGACAAGGGAGCTCAAGATG
TACAGTAAAACGGCGGTGCAGAAGCGTCCTCCGTCATCCAGCAAGGAGCGCATTATCCAACGCAAGGCCAGCGAC
GTTCTTCGACTGGTCCTGGATGAGGTTGGAATGAATGACAACTTTTTCCAACTCGGTGGAGATTCAATTGCAGCA
ATGAAGCTGGCTGGGGCTGTTAGGGATAGTGGGTTTCATGTCACAGTCGCCGACATTTTTAGCCATCCTCGTCTA
GGAGACCTGGCGGCCAGATTGGAAAAGAGCGATGCCGGCAGCGCCCCGAAAATTGCACCCTTTGAGCTACTGCCC
GAGACAAAGCGGCCCAGCATAATGCAAGCCGCTGCCAGTCAGTGCCAAGTTGACGTGAATACGATTCAAGACTTG
TATCCTTGCACGCCTATGCAGGAAGCACTCCTGGCACTGGCCATGAAGCAGAGCGGCCAATACGTCGCCGAGCTG
ACCTTTGACCTTGGCCATGACGTCGACGTTGATCGAGTAAAGGCTGCCTGGGAAGCTGTATACGCTGCAAGCTCG
ATCCTAAGGACGCGCATCATCCCGCCCTTGACAAGTTTGGATTCTTCGCTCCAAGTCGTCATCAAGGAGCCGCTG
TTCTGGTCGTCAGACTCGCATCCTTTGGAGGCTGAGAATGGGAAGGCGCTGCACAAGGCTGCCATTTATCATGAA
GCGGGACAGGGGAAACTGCGAATATGGCTCCATCATGCGCTTTATGATGGAACATCTCTGCCTCTGCTTCTTGAA
CAAGCAGAGGCAGCTTACAACGGATGCTCGCCATTGTCCAAACCATTTAATATATTTGCCGCTTATACTCAGACG
CTCAATGGTGAAGAAGGCAGACAGTTTTGGGAGGGTGAGATGAAGGGCTTAAACACCACCATGTTTCCGCTGCTG
CGAAGCCCACACTTGTCGGGAAAACGAGAGTTTGTGTCGTGCGACATTTCGATCCCCAACGTCAAAGGCAGCGAG
TTTACACTGCCGTCCTTGATTCACTCAGTCTGCGCCGCCAGTCTCGGACACTTTGCAAATACTGACGACGTGGTG
TATGGGATCACGCTGGCGGGCAGAGATGCTCCTGTTGACGGAATCGAGAGCCTGATTGGTCCAACCATGACAACG
GTGCCGTTTCGAGTGCAGCCATGGCCCAAGTGGTCGATGCAAGAGTTGATGCTTGATATCCAAGACCGTTTGGCC
AGACTCATGCCCTTTGAGCACACGGGCCTTCAAGCAATAAGGCAGTTTAGTGCCGAGTGCGCTGTAGCGTGCGAC
TTTGACTGCCACGTGGTGATTCAGCCGGCCGATGAAGGGACGGAAAACAAGGTGTTCAAGGAAACTGCTAGGAGC
GACGACGTCTACTCCAACTTTTCCAACTCGCCACTCTTGCTCGTCTTTACACTTTCAGCCGATAGACGGTCGGTG
CATCTAGTTGTCAATTTTGATGTCTCCCATCTCGATGCGGTTGAGGCGACAAACTTTGCGCAACATCTGGACCAT
GGCATTCAGCAGGCCATGCTAGATGCGACTTTGCCCGTTGAAAAGATTCAGATGGCAAGCCCGCATCACATGGCC
CTTCTCGAAAATCGCAATGCCCTTGTTCCGCCCAGGCTGGATATGCTGGTGCATGAATTAGTGGCGGAGCAGTGT
CGTCGTCGGCCAAGCGCCCAAGCCGTCGCTTCATGGGACGGATCGCTGACATATGGGCAACTCGACAATTTCAGT
GCCATGTTGGCGCAGCATCTCTTGACACACGGGGCCGGGCCTGGAAAGGTGGCTGCGCTGTGTATGCCAAAGTCG
CAATGGGCCGTTGTGGCCGTCTTGTCTGCTCTCAAGTCGGGCTCAGCGTGCGCCATGATGGATGCATCCCACCCA
AAAGGGCGCATGCAGGAAATCGTCAACCAGACCAGCGCCGCCATTGTTTTGGCGTCGCCAGAGACTCGCGAGACG
GCTCAAGCCATTGCTGCAGGCGCCATGGTGGTTGTGGTGTCGCCTGCTTTGCTTCATGGTTTGCCCGCGCCAGAT
TCCAAGATTTGCTCCGCTGTGACTTGCTCAGACGTTGCTTGCATTTTCTTCACGTCTGGGAGCACGGGAAAGTCC
AAGGGATTCACCTTGGAGCACGCGAGCATCTCGACTGGGCTACGAGATCTCCGAGGCCCGCTTGGCTGGGACCAG
GATTCGCGCATGCTGCACTTTGCTTCGTATGCTTTTGACATGGGCCTTCTTGAGCTTCTAGGGAGCATGGCGGTT
GGGGCGTGTCTATGTATTCCCTCTGACACGGACCGCATGTCGAATCTTTGCGGCTTCATCGAGGCCAAACAGGTC
AACTGGGGCTTCATGATTCCATCCACCTCGCATCTCCTAGATGCTCTCAGCGTTCCATCACTCAAGACACTAGTC
ATGGGCGGCGAGGCCCCCAAGCTGGCTGATATCCAGCGCTGGGCCGCGAGAAAAGACGTGCGCCTCCTAAATTTA
TATGGCCCGGCTGAGTGCATGGTTGGAGTGACTTGCGGCCTCATGTCGCCAACAGAATGGATACATGGTCTCAGT
GGCCATGTTGTCAATGGTGTCGGTTGGATTGCAAGTCCTCGCGACCCTAGCCAACTCTGTGCTGTTGGGGCCATG
GGCGAGTTGCTGGTTGAGGGTGCTCATCTCGCACGGGAGTATCTTGGCGATGCAGAAAAGACCAGCGCCAGTTTT
ATTCCCAGCCCGCCCTGGCTTACTCGCTTCCGCGGGCACGATGGAAACCGTCTTTACCGAACCGGTGATCTCTTT
CAGCTCATGAGCAACGGCTCCGTCAGATTCATTGGCCGCAAGGACCGGCAGGTAAAGCTAAATGGCCAACGCATC
GAGCCGCAAGAGGTTGAAAGTAATCTCATGGCGCTTTTCCCACAAGACACCATGGTCATTGTCGATGTCGTTGTG
CAGAAGTCGCCAGCGCCTCGACAGCGACTTGTTGCTTTTATCCATGTTGCAGACGGCAAGCCCAAGCCTTGTTTC
TCTTCGCATCAAGATTCATTATTCGCCAGCCCAGACATTGACCTGTTGAAGCTTTGTCGCGCTGCCAAGCAAAAG
ATTAGCGAGTCGCTGCCGCGCTACATGATACCCGAGACATTTATCCCCTTGACCCGTGTGCCCCGAACAGTTAGC
GGCAAGATTAATCGCGGCTTGCTCTGCGATGCAGCCAGTACGCTACAGGGCCCCGACTTGGATCGTCTATCGGGC
CTTGCAACTATAGAGTCTCGGCCACTTGACAAGTTGGAGACGGACATGGCTGTGCTGTGGACAGACGTCTTGGGC
TTGCAGCTAGACGCCGTGAGCGCAAACGAAAACTTTTTCCACGTTGGAGGCGACTCCATCACAGCCATGAAACTT
GTCGGAGCCGCTCGTTCACAGGGGATTTCCATGACTGTGCCGCAAATATTTGCTCATCCGCGTCTGGCCGACTTG
GTCAGAGTTGCCAAGTTTGACAGCAAGGTAAATGGAGTGGAAGCTGCCATTGAGCCATTTTCTCTACTTGCAGAG
CATGAGAGAGAAGTGGTGCTCAAGACAGCCGAGCGGCAATGTTTGCTTCCAAGAACGCAGATTGAGGACATTTAT
CCTTGCACGCCGCTGCAAGAGGCTCTTGTTTCGCAGTCGATGCGCTCTTCAAGTGCCTACATGGGACGCTTTAGA
TACAAACTCGGCTCGCAAGTCGATGTGTCTCGATTTACACAGGCATGGAGCCATGTTGTCAGAGCAAATCCCATC
TTGCGCACCAGAATGATTCAGACTTTAGCCATGTACCAAGTGGTGCTGCTGGAAGAGGCAACCTTTGAAACCGTC
GACTCGGACTCGCTGGACGGCTTTGAGTCGCAGCTACAAAAAGACGGGATTCAAATGGGCTGTCCACTCCTGCAA
CTCGTCCTCAGCCAGCCCAAGACTTGTGGGGTTGATGTGGAATTTTGCCTCCTTCTTCATCATGCCTTGTATGAT
GCATGGTCCATTGACTTGATATTGGGCCAGGTGCGCCAAGCTTATGCCGGCAAGACGCCCGTCTGTCAGCCTTTT
AACCGCTTTATTGACTATACTGTTAGACAGAAGCAAGACGCCATGGAAAGCTACTGGCTCAAGCAGCTGTCTGAT
GCGAGTCAAGTCGTGTTCCCAGCACTGCCTAGAAGCGACTACAAGCCCTTTACTGATTCAGACATTCGACAAGAG
GTCCAAGTCGTGCCTGTTTTGGGCATTACTTTTGCAACGTTGCTCGAGTTTTCCTGGGCGGCTACACTTTCTCAG
TACTGCGACTCTGGAGGAGTTACGCATGGGCTCGTTCTCTCGGGGCGCAACGCCAATGTTGCAGGCATTGAATCC
ATTGCCGGGCCAACCATTGCCACCATTCCCGTTTGTTTCACGCCTCAACGAGGCCAACACGTCTTTTCTGAGCTG
CATAGGCTGCAGGCCGAGAGAGCGGCAGCTACGCCGTTTGAGCATTTCGGCCTGGCAAACATTCGCCGGCTGAGC
AACCAGTCGGAAGCGGCGTGCCAGTTTCAAAGCCTCTTGCTCATTCAGCAAGCCAAAATCGCCTCGACCGACGAC
CTTTTCCTGCCCGTTGCTGAAAAGGTGACTGCTGGAGATTTTAGCGCCTTTGCACTCGAGATTTGCTGTGAGCTT
TCTAGAGGCGGATGCGCAATTACCTTGAGCTACGACTCCAACGTGCTGGACGGGCGGCAGGCTGCAAGGTTGTTG
GCACAGTTTACGCACACGCTCTGTCAAGTACAAGCTCATCCCGACAAGGTGCTGTCGGAACTGAATCTTGTCACT
CCATTAACCTGGAACACGTTGTTGGAATGGAACAGGATTCTTCCCAGTGCTGTCAACCGCTGCATTCATGATGGT
ATCAAGAAGCAATGCGTCAGTGCTCCAGACGCCCAAGCGGTGTGTGCATGGGACGGCAACTTGTCATACCGCGAG
CTGCATGACTTGTCCTCGAGGCTCGCTTTTCATCTACAGAGCTTTGGTCTCGGCTCCGAATCGTTTGTTCCCATC
TTGTCCGAAAAGTCGGTTTGGGTAGCCATCGCCATCATGGGAGTTATCAAAGCTGGCGGCGCCATTGTCCTACTT
GACCCAGTACTGCCATTTCAGCGCTTGCAGACCATTTTCTCAAGCGTCGATGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail