Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6470
Gene name
LocationContig_6:97911..98970
Strand-
Gene length (bp)1059
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59121|PLD_ARCHD Phospholipase D OS=Arcanobacterium haemolyticum (strain ATCC 9345 / DSM 20595 / NBRC 15585 / NCTC 8452 / 11018) GN=pld PE=3 SV=2 80 352 1.0E-45
sp|Q59332|PLD_CORUL Phospholipase D OS=Corynebacterium ulcerans GN=pld PE=3 SV=1 80 352 2.0E-44
sp|B8NQ51|SMD_ASPFN Sphingomyelinase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_004420 PE=1 SV=1 83 352 5.0E-44
sp|P20626|PLD_CORPS Phospholipase D OS=Corynebacterium pseudotuberculosis GN=pld PE=1 SV=1 85 352 1.0E-42
sp|D4AZV8|SMD_ARTBC Sphingomyelinase D OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01728 PE=3 SV=1 91 352 8.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59121|PLD_ARCHD Phospholipase D OS=Arcanobacterium haemolyticum (strain ATCC 9345 / DSM 20595 / NBRC 15585 / NCTC 8452 / 11018) GN=pld PE=3 SV=2 80 352 1.0E-45
sp|Q59332|PLD_CORUL Phospholipase D OS=Corynebacterium ulcerans GN=pld PE=3 SV=1 80 352 2.0E-44
sp|B8NQ51|SMD_ASPFN Sphingomyelinase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_004420 PE=1 SV=1 83 352 5.0E-44
sp|P20626|PLD_CORPS Phospholipase D OS=Corynebacterium pseudotuberculosis GN=pld PE=1 SV=1 85 352 1.0E-42
sp|D4AZV8|SMD_ARTBC Sphingomyelinase D OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01728 PE=3 SV=1 91 352 8.0E-40
sp|F2SCC4|SMD_TRIRC Sphingomyelinase D OS=Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) GN=TERG_01406 PE=3 SV=1 88 352 5.0E-39
sp|J3K844|SMD_COCIM Sphingomyelinase D OS=Coccidioides immitis (strain RS) GN=CIMG_06182 PE=3 SV=1 81 352 1.0E-36
sp|C0NUU1|SMD_AJECG Sphingomyelinase D OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_06705 PE=3 SV=1 89 352 1.0E-35
sp|C0S3M9|SMD_PARBP Sphingomyelinase D OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02293 PE=3 SV=1 88 352 2.0E-30
sp|C4JUE5|SMD_UNCRE Sphingomyelinase D OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_04748 PE=3 SV=1 89 352 5.0E-30
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6470
MKLTLLSVFTLTLFGATALMLQDCQKLDPSNLLIKSLPSNATLETQRLAQYCRQCRRHDACTSSHGYNRCKVPWQ
KFIHICQCVAAVQQRPIYLIAGSVLESKNIAVALDHGANAIEIDATAWERSWWADQAGNIFSRGDSMEDLLKTIA
KLVQQGRYIGFVWLQIRNPDYCNLVTHRTCAVNGLRDIVHRHLSRLRVPVLYGFPRNYNNELVGGGSDTADNLLP
HEALAIQGLSSVVQHSFDDMGLSNERLRVITDGYFDWATGFWPWRDDIAQSVKSQAFQRVFAWTYAGGRTDNLDS
MMDTGIDGIVYGFKHTAYYAHTNVRNAAQEIKQWINSHPHRARLATKGDVPW*
Coding >OphauB2|6470
ATGAAGCTCACCCTCTTGTCCGTCTTTACCCTCACCCTCTTTGGCGCCACTGCCCTCATGCTGCAAGACTGCCAA
AAGCTGGATCCATCCAACCTGCTCATCAAGTCTTTACCCAGCAACGCAACGCTAGAAACCCAACGACTAGCTCAA
TACTGCCGCCAGTGTCGCCGCCACGACGCATGCACCAGCTCGCACGGCTACAATAGATGCAAAGTGCCGTGGCAG
AAATTCATACACATTTGCCAGTGCGTCGCGGCAGTGCAGCAGCGCCCCATTTACCTCATTGCCGGCAGCGTCTTG
GAAAGCAAAAACATTGCCGTGGCGCTGGACCATGGCGCCAATGCTATTGAAATCGACGCCACGGCCTGGGAGAGG
AGCTGGTGGGCCGACCAGGCAGGCAACATCTTTAGCCGGGGCGACTCCATGGAAGACTTGCTCAAGACGATTGCT
AAACTGGTTCAGCAGGGCCGCTACATTGGCTTCGTCTGGCTCCAGATTCGAAACCCAGACTACTGCAACCTCGTT
ACCCATCGTACCTGTGCCGTCAACGGCCTTCGAGACATTGTGCACAGACATCTCTCGAGGCTGCGCGTCCCCGTG
CTCTACGGCTTTCCCCGCAACTACAACAATGAACTCGTAGGCGGCGGCAGCGACACTGCTGATAATCTACTCCCT
CACGAGGCCCTGGCCATACAGGGACTCTCGTCAGTGGTGCAGCACTCTTTTGACGACATGGGCCTGTCCAACGAG
CGTCTGCGCGTCATTACAGACGGCTACTTTGACTGGGCCACGGGATTCTGGCCTTGGAGAGACGACATTGCCCAG
TCGGTAAAGTCGCAAGCTTTCCAAAGAGTCTTTGCCTGGACCTATGCCGGTGGGCGCACCGATAATCTAGACTCC
ATGATGGATACGGGCATTGATGGCATCGTCTACGGCTTCAAACATACAGCCTACTACGCACACACAAATGTCAGA
AATGCCGCCCAGGAAATCAAGCAATGGATAAACAGTCATCCTCATAGGGCTCGTCTGGCCACCAAGGGAGACGTG
CCCTGGTGA
Transcript >OphauB2|6470
ATGAAGCTCACCCTCTTGTCCGTCTTTACCCTCACCCTCTTTGGCGCCACTGCCCTCATGCTGCAAGACTGCCAA
AAGCTGGATCCATCCAACCTGCTCATCAAGTCTTTACCCAGCAACGCAACGCTAGAAACCCAACGACTAGCTCAA
TACTGCCGCCAGTGTCGCCGCCACGACGCATGCACCAGCTCGCACGGCTACAATAGATGCAAAGTGCCGTGGCAG
AAATTCATACACATTTGCCAGTGCGTCGCGGCAGTGCAGCAGCGCCCCATTTACCTCATTGCCGGCAGCGTCTTG
GAAAGCAAAAACATTGCCGTGGCGCTGGACCATGGCGCCAATGCTATTGAAATCGACGCCACGGCCTGGGAGAGG
AGCTGGTGGGCCGACCAGGCAGGCAACATCTTTAGCCGGGGCGACTCCATGGAAGACTTGCTCAAGACGATTGCT
AAACTGGTTCAGCAGGGCCGCTACATTGGCTTCGTCTGGCTCCAGATTCGAAACCCAGACTACTGCAACCTCGTT
ACCCATCGTACCTGTGCCGTCAACGGCCTTCGAGACATTGTGCACAGACATCTCTCGAGGCTGCGCGTCCCCGTG
CTCTACGGCTTTCCCCGCAACTACAACAATGAACTCGTAGGCGGCGGCAGCGACACTGCTGATAATCTACTCCCT
CACGAGGCCCTGGCCATACAGGGACTCTCGTCAGTGGTGCAGCACTCTTTTGACGACATGGGCCTGTCCAACGAG
CGTCTGCGCGTCATTACAGACGGCTACTTTGACTGGGCCACGGGATTCTGGCCTTGGAGAGACGACATTGCCCAG
TCGGTAAAGTCGCAAGCTTTCCAAAGAGTCTTTGCCTGGACCTATGCCGGTGGGCGCACCGATAATCTAGACTCC
ATGATGGATACGGGCATTGATGGCATCGTCTACGGCTTCAAACATACAGCCTACTACGCACACACAAATGTCAGA
AATGCCGCCCAGGAAATCAAGCAATGGATAAACAGTCATCCTCATAGGGCTCGTCTGGCCACCAAGGGAGACGTG
CCCTGGTGA
Gene >OphauB2|6470
ATGAAGCTCACCCTCTTGTCCGTCTTTACCCTCACCCTCTTTGGCGCCACTGCCCTCATGCTGCAAGACTGCCAA
AAGCTGGATCCATCCAACCTGCTCATCAAGTCTTTACCCAGCAACGCAACGCTAGAAACCCAACGACTAGCTCAA
TACTGCCGCCAGTGTCGCCGCCACGACGCATGCACCAGCTCGCACGGCTACAATAGATGCAAAGTGCCGTGGCAG
AAATTCATACACATTTGCCAGTGCGTCGCGGCAGTGCAGCAGCGCCCCATTTACCTCATTGCCGGCAGCGTCTTG
GAAAGCAAAAACATTGCCGTGGCGCTGGACCATGGCGCCAATGCTATTGAAATCGACGCCACGGCCTGGGAGAGG
AGCTGGTGGGCCGACCAGGCAGGCAACATCTTTAGCCGGGGCGACTCCATGGAAGACTTGCTCAAGACGATTGCT
AAACTGGTTCAGCAGGGCCGCTACATTGGCTTCGTCTGGCTCCAGATTCGAAACCCAGACTACTGCAACCTCGTT
ACCCATCGTACCTGTGCCGTCAACGGCCTTCGAGACATTGTGCACAGACATCTCTCGAGGCTGCGCGTCCCCGTG
CTCTACGGCTTTCCCCGCAACTACAACAATGAACTCGTAGGCGGCGGCAGCGACACTGCTGATAATCTACTCCCT
CACGAGGCCCTGGCCATACAGGGACTCTCGTCAGTGGTGCAGCACTCTTTTGACGACATGGGCCTGTCCAACGAG
CGTCTGCGCGTCATTACAGACGGCTACTTTGACTGGGCCACGGGATTCTGGCCTTGGAGAGACGACATTGCCCAG
TCGGTAAAGTCGCAAGCTTTCCAAAGAGTCTTTGCCTGGACCTATGCCGGTGGGCGCACCGATAATCTAGACTCC
ATGATGGATACGGGCATTGATGGCATCGTCTACGGCTTCAAACATACAGCCTACTACGCACACACAAATGTCAGA
AATGCCGCCCAGGAAATCAAGCAATGGATAAACAGTCATCCTCATAGGGCTCGTCTGGCCACCAAGGGAGACGTG
CCCTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail