Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6468
Gene name
LocationContig_6:92315..93848
Strand+
Gene length (bp)1533
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 7.5E-46 133 471
PF00756 Esterase Putative esterase 8.3E-05 211 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10341|CYS2_SCHPO Probable serine-O-acetyltransferase cys2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cys2 PE=1 SV=1 45 510 0.0E+00
sp|Q2RIW8|METX_MOOTA Homoserine O-acetyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=metX PE=3 SV=1 97 374 2.0E-84
sp|Q5H124|METX_XANOR Homoserine O-acetyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=metX PE=3 SV=1 106 509 2.0E-82
sp|Q2P3Z2|METX_XANOM Homoserine O-acetyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metX PE=3 SV=1 106 509 2.0E-82
sp|Q3BSK1|METX_XANC5 Homoserine O-acetyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metX PE=3 SV=1 111 509 5.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10341|CYS2_SCHPO Probable serine-O-acetyltransferase cys2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cys2 PE=1 SV=1 45 510 0.0E+00
sp|Q2RIW8|METX_MOOTA Homoserine O-acetyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=metX PE=3 SV=1 97 374 2.0E-84
sp|Q5H124|METX_XANOR Homoserine O-acetyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=metX PE=3 SV=1 106 509 2.0E-82
sp|Q2P3Z2|METX_XANOM Homoserine O-acetyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metX PE=3 SV=1 106 509 2.0E-82
sp|Q3BSK1|METX_XANC5 Homoserine O-acetyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metX PE=3 SV=1 111 509 5.0E-82
sp|B2FMC1|METX_STRMK Homoserine O-acetyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=metX PE=3 SV=1 111 510 2.0E-80
sp|Q8PK44|METX_XANAC Homoserine O-acetyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metX PE=3 SV=1 111 509 3.0E-80
sp|Q8P8L2|METX_XANCP Homoserine O-acetyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=metX PE=3 SV=1 111 509 5.0E-78
sp|B0RS70|METX_XANCB Homoserine O-acetyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=metX PE=3 SV=1 111 509 5.0E-78
sp|Q4UVH1|METX_XANC8 Homoserine O-acetyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=metX PE=3 SV=1 111 509 5.0E-78
sp|Q9AAS1|METX_CAUCR Homoserine O-acetyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metX PE=3 SV=1 93 376 3.0E-76
sp|B8GZZ0|METX_CAUCN Homoserine O-acetyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=metX PE=3 SV=1 93 376 3.0E-76
sp|Q2RP84|METX_RHORT Homoserine O-acetyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=metX PE=3 SV=1 102 377 4.0E-75
sp|Q5NR05|METX_ZYMMO Homoserine O-acetyltransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=metX PE=3 SV=1 106 510 1.0E-74
sp|Q98G09|METX_RHILO Homoserine O-acetyltransferase OS=Rhizobium loti (strain MAFF303099) GN=metX PE=3 SV=1 96 377 3.0E-74
sp|Q1QQD3|METX_NITHX Homoserine O-acetyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=metX PE=3 SV=1 106 385 4.0E-74
sp|Q3SV39|METX_NITWN Homoserine O-acetyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=metX PE=3 SV=1 106 385 5.0E-74
sp|Q3AAW2|METX_CARHZ Homoserine O-acetyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metX PE=3 SV=1 106 374 6.0E-74
sp|Q6ANV2|METX_DESPS Homoserine O-acetyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=metX PE=3 SV=2 106 509 1.0E-73
sp|Q89UL7|METX_BRADU Homoserine O-acetyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=metX PE=3 SV=1 106 374 1.0E-73
sp|A1AUS2|METX_PELPD Homoserine O-acetyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=metX PE=3 SV=1 98 390 2.0E-72
sp|Q04RK8|METX_LEPBJ Homoserine O-acetyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=metX PE=3 SV=1 106 510 1.0E-71
sp|Q6N1G8|METX_RHOPA Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metX PE=3 SV=1 108 385 2.0E-71
sp|Q87BG9|METX_XYLFT Homoserine O-acetyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metX PE=3 SV=1 111 510 3.0E-71
sp|B2I700|METX_XYLF2 Homoserine O-acetyltransferase OS=Xylella fastidiosa (strain M23) GN=metX PE=3 SV=1 111 510 3.0E-71
sp|B9M4M5|METX_GEODF Homoserine O-acetyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=metX PE=3 SV=1 106 374 3.0E-71
sp|Q67NS3|METX_SYMTH Homoserine O-acetyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metX PE=3 SV=1 106 375 4.0E-71
sp|D2Z028|DCSE_STRLA L-serine/homoserine O-acetyltransferase OS=Streptomyces lavendulae GN=dcsE PE=1 SV=1 104 372 5.0E-71
sp|B0U3V7|METX_XYLFM Homoserine O-acetyltransferase OS=Xylella fastidiosa (strain M12) GN=metX PE=3 SV=1 111 510 5.0E-71
sp|Q3A7G2|METX_PELCD Homoserine O-acetyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=metX PE=3 SV=2 89 391 6.0E-71
sp|Q2IS70|METX_RHOP2 Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=metX PE=3 SV=1 84 385 6.0E-71
sp|Q9PAN0|METX_XYLFA Homoserine O-acetyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=metX PE=3 SV=1 111 510 8.0E-71
sp|B5EAS1|METX_GEOBB Homoserine O-acetyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=metX PE=3 SV=1 106 510 1.0E-70
sp|Q20YI1|METX_RHOPB Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=metX PE=3 SV=1 106 376 2.0E-70
sp|Q5FUF4|METX_GLUOX Homoserine O-acetyltransferase OS=Gluconobacter oxydans (strain 621H) GN=metX PE=3 SV=1 90 509 2.0E-69
sp|Q74AC8|METX_GEOSL Homoserine O-acetyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=metX PE=3 SV=1 98 374 2.0E-69
sp|Q8F4I0|METX_LEPIN Homoserine O-acetyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=metX PE=1 SV=1 106 388 6.0E-69
sp|Q72R95|METX_LEPIC Homoserine O-acetyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=metX PE=3 SV=1 106 388 6.0E-69
sp|Q052B3|METX_LEPBL Homoserine O-acetyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=metX PE=3 SV=1 106 388 6.0E-69
sp|A0LCI7|METX_MAGMM Homoserine O-acetyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=metX PE=3 SV=1 106 373 1.0E-68
sp|A5GC94|METX_GEOUR Homoserine O-acetyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=metX PE=3 SV=1 106 374 2.0E-68
sp|Q65U29|METX_MANSM Homoserine O-acetyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metX PE=3 SV=2 106 417 5.0E-68
sp|Q39RX3|METX_GEOMG Homoserine O-acetyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=metX PE=3 SV=1 98 373 1.0E-67
sp|Q47L17|METX_THEFY Homoserine O-acetyltransferase OS=Thermobifida fusca (strain YX) GN=metX PE=3 SV=1 106 389 1.0E-67
sp|A1SMU5|METX_NOCSJ Homoserine O-acetyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=metX PE=3 SV=1 104 389 1.0E-67
sp|A6SUC4|METX_JANMA Homoserine O-acetyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=metX PE=3 SV=1 98 373 2.0E-67
sp|B1YPU9|METX_BURA4 Homoserine O-acetyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=metX PE=3 SV=1 98 373 1.0E-66
sp|Q0BAW3|METX_BURCM Homoserine O-acetyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metX PE=3 SV=1 98 373 2.0E-66
sp|A9AC42|METX_BURM1 Homoserine O-acetyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=metX PE=3 SV=1 98 373 2.0E-66
sp|A5FVN0|METX_ACICJ Homoserine O-acetyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=metX PE=3 SV=1 98 376 2.0E-66
sp|A0KBH0|METX_BURCH Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=metX PE=3 SV=1 98 373 3.0E-66
sp|B1K0G8|METX_BURCC Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=metX PE=3 SV=1 98 373 3.0E-66
sp|Q1BSM1|METX_BURCA Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=metX PE=3 SV=1 98 373 3.0E-66
sp|A1KCN1|METX_AZOSB Homoserine O-acetyltransferase OS=Azoarcus sp. (strain BH72) GN=metX PE=3 SV=1 88 389 3.0E-66
sp|P94891|METX_LEPME Homoserine O-acetyltransferase OS=Leptospira meyeri GN=metX PE=3 SV=1 104 387 4.0E-66
sp|Q2T284|METX_BURTA Homoserine O-acetyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metX PE=3 SV=1 98 373 4.0E-66
sp|Q63YJ0|METX_BURPS Homoserine O-acetyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|A3N4G4|METX_BURP6 Homoserine O-acetyltransferase OS=Burkholderia pseudomallei (strain 668) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|A3NQ54|METX_BURP0 Homoserine O-acetyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|A1V7J8|METX_BURMS Homoserine O-acetyltransferase OS=Burkholderia mallei (strain SAVP1) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|Q62F07|METX_BURMA Homoserine O-acetyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|A2S877|METX_BURM9 Homoserine O-acetyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|A3MRS1|METX_BURM7 Homoserine O-acetyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|Q3JXB2|METX_BURP1 Homoserine O-acetyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=metX PE=3 SV=1 98 373 6.0E-66
sp|B4E7Y5|METX_BURCJ Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=metX PE=3 SV=1 98 373 6.0E-66
sp|B0SQZ8|METX_LEPBP Homoserine O-acetyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=metX PE=3 SV=1 104 387 3.0E-65
sp|B0SHJ0|METX_LEPBA Homoserine O-acetyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=metX PE=3 SV=1 104 387 3.0E-65
sp|Q4FUR4|METX_PSYA2 Homoserine O-acetyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=metX PE=3 SV=1 98 510 4.0E-65
sp|A1WVL3|METX_HALHL Homoserine O-acetyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=metX PE=3 SV=1 111 496 5.0E-65
sp|A4JIS1|METX_BURVG Homoserine O-acetyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=metX PE=3 SV=1 98 373 6.0E-65
sp|Q39BX2|METX_BURL3 Homoserine O-acetyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metX PE=3 SV=1 98 373 7.0E-65
sp|Q3B5A5|METX_CHLL7 Homoserine O-acetyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=metX PE=3 SV=1 97 509 7.0E-65
sp|A4G1K0|METX_HERAR Homoserine O-acetyltransferase OS=Herminiimonas arsenicoxydans GN=metX PE=3 SV=2 98 373 1.0E-64
sp|B3E278|METX_GEOLS Homoserine O-acetyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=metX PE=3 SV=1 98 390 1.0E-64
sp|B1XW69|METX_LEPCP Homoserine O-acetyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=metX PE=3 SV=1 98 388 2.0E-64
sp|B2IY96|METX_NOSP7 Homoserine O-acetyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=metX PE=3 SV=1 97 498 4.0E-64
sp|Q4FP51|METX_PELUB Homoserine O-acetyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=metX PE=3 SV=1 106 374 7.0E-64
sp|Q5P4R1|METX_AROAE Homoserine O-acetyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=metX PE=3 SV=1 98 373 7.0E-64
sp|B2T1N1|METX_BURPP Homoserine O-acetyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=metX PE=3 SV=1 101 373 8.0E-64
sp|P45131|METX_HAEIN Homoserine O-acetyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metX PE=1 SV=3 106 385 2.0E-63
sp|Q7W0P6|METX_BORPE Homoserine O-acetyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metX PE=3 SV=1 111 373 2.0E-63
sp|Q7WES8|METX_BORBR Homoserine O-acetyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metX PE=3 SV=1 111 373 2.0E-63
sp|Q7W3F8|METX_BORPA Homoserine O-acetyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metX PE=3 SV=1 111 373 2.0E-63
sp|B2JJW9|METX_BURP8 Homoserine O-acetyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=metX PE=3 SV=1 98 373 3.0E-63
sp|B3PFK3|METX_CELJU Homoserine O-acetyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=metX PE=3 SV=1 98 509 3.0E-63
sp|P57884|METX_PASMU Homoserine O-acetyltransferase OS=Pasteurella multocida (strain Pm70) GN=metX PE=3 SV=1 108 389 3.0E-63
sp|Q4QJY8|METX_HAEI8 Homoserine O-acetyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=metX PE=3 SV=1 106 385 4.0E-63
sp|B5ELV1|METX_ACIF5 Homoserine O-acetyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metX PE=3 SV=1 106 373 4.0E-63
sp|B7J437|METX_ACIF2 Homoserine O-acetyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=metX PE=3 SV=1 106 373 4.0E-63
sp|Q6ADB9|METX_LEIXX Homoserine O-acetyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=metX PE=3 SV=1 105 509 5.0E-63
sp|Q476W5|METX_CUPPJ Homoserine O-acetyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=metX PE=3 SV=1 98 388 6.0E-63
sp|A2SLU8|METX_METPP Homoserine O-acetyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=metX PE=3 SV=1 98 373 1.0E-62
sp|Q2YCJ2|METX_NITMU Homoserine O-acetyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=metX PE=3 SV=1 106 373 2.0E-62
sp|Q0KF58|METX_CUPNH Homoserine O-acetyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metX PE=3 SV=1 88 388 3.0E-62
sp|Q146X7|METX_BURXL Homoserine O-acetyltransferase OS=Burkholderia xenovorans (strain LB400) GN=metX PE=3 SV=1 98 373 3.0E-62
sp|Q0ABU4|METX_ALKEH Homoserine O-acetyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=metX PE=3 SV=1 98 377 3.0E-62
sp|B3QM89|METX_CHLP8 Homoserine O-acetyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=metX PE=3 SV=1 90 375 4.0E-62
sp|A6UYJ9|METX_PSEA7 Homoserine O-acetyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=metX PE=3 SV=1 98 496 6.0E-62
sp|Q47JU2|METX_DECAR Homoserine O-acetyltransferase OS=Dechloromonas aromatica (strain RCB) GN=metX PE=3 SV=1 98 373 9.0E-62
sp|Q5SK89|METX_THET8 Homoserine O-acetyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=metX PE=3 SV=1 103 509 1.0E-61
sp|Q9RA51|METX_THET2 Homoserine O-acetyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=metX PE=3 SV=2 103 509 1.0E-61
sp|C1DI67|METX_AZOVD Homoserine O-acetyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=metX PE=3 SV=1 98 373 1.0E-61
sp|Q8Y3F3|METX_RALSO Homoserine O-acetyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=metX PE=3 SV=1 101 373 1.0E-61
sp|Q1LS47|METX_CUPMC Homoserine O-acetyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metX PE=3 SV=1 98 373 3.0E-61
sp|Q3M5Q6|METX_ANAVT Homoserine O-acetyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=metX PE=3 SV=1 97 391 3.0E-61
sp|Q92E58|METX_LISIN Homoserine O-acetyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metX PE=3 SV=1 106 376 3.0E-61
sp|Q8Y9D6|METX_LISMO Homoserine O-acetyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metX PE=3 SV=1 106 376 4.0E-61
sp|C1D4Z8|METX_LARHH Homoserine O-acetyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=metX PE=3 SV=1 106 373 4.0E-61
sp|B2AGC8|METX_CUPTR Homoserine O-acetyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=metX PE=3 SV=1 88 388 5.0E-61
sp|Q722V6|METX_LISMF Homoserine O-acetyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metX PE=3 SV=1 106 376 6.0E-61
sp|Q4ZZ78|METX_PSEU2 Homoserine O-acetyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metX PE=3 SV=1 98 373 9.0E-61
sp|P57714|METX_PSEAE Homoserine O-acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metX PE=3 SV=1 98 496 1.0E-60
sp|Q02U23|METX_PSEAB Homoserine O-acetyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metX PE=3 SV=1 98 496 1.0E-60
sp|B2U7Y8|METX_RALPJ Homoserine O-acetyltransferase OS=Ralstonia pickettii (strain 12J) GN=metX PE=3 SV=1 101 388 1.0E-60
sp|P57715|METX_HALSA Homoserine O-acetyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=metX PE=3 SV=2 104 509 1.0E-60
sp|Q8KES7|METX_CHLTE Homoserine O-acetyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=metX PE=3 SV=1 97 375 2.0E-60
sp|Q2S8M0|METX_HAHCH Homoserine O-acetyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=metX PE=3 SV=1 106 373 2.0E-60
sp|B1J2H5|METX_PSEPW Homoserine O-acetyltransferase OS=Pseudomonas putida (strain W619) GN=metX PE=3 SV=1 84 373 2.0E-60
sp|A5WAD0|METX_PSEP1 Homoserine O-acetyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=metX PE=3 SV=1 84 373 2.0E-60
sp|B3QZ51|METX_CHLT3 Homoserine O-acetyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=metX PE=3 SV=1 92 374 2.0E-60
sp|B7V3X6|METX_PSEA8 Homoserine O-acetyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=metX PE=3 SV=1 98 496 3.0E-60
sp|Q0BVW2|METX_GRABC Homoserine O-acetyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=metX PE=3 SV=1 103 377 5.0E-60
sp|A4XZY6|METX_PSEMY Homoserine O-acetyltransferase OS=Pseudomonas mendocina (strain ymp) GN=metX PE=3 SV=1 85 373 5.0E-60
sp|Q7NZY3|METX_CHRVO Homoserine O-acetyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=metX PE=3 SV=1 111 373 8.0E-60
sp|Q0AIM3|METX_NITEC Homoserine O-acetyltransferase OS=Nitrosomonas eutropha (strain C91) GN=metX PE=3 SV=1 101 373 8.0E-60
sp|Q2KU63|METX_BORA1 Homoserine O-acetyltransferase OS=Bordetella avium (strain 197N) GN=metX PE=3 SV=1 69 497 1.0E-59
sp|Q87V90|METX_PSESM Homoserine O-acetyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metX PE=3 SV=1 98 373 1.0E-59
sp|A4VRJ2|METX_PSEU5 Homoserine O-acetyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=metX PE=3 SV=1 98 373 2.0E-59
sp|Q88CT3|METX_PSEPK Homoserine O-acetyltransferase OS=Pseudomonas putida (strain KT2440) GN=metX PE=3 SV=1 84 373 2.0E-59
sp|Q48PA1|METX_PSE14 Homoserine O-acetyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metX PE=3 SV=1 98 373 2.0E-59
sp|B0KN51|METX_PSEPG Homoserine O-acetyltransferase OS=Pseudomonas putida (strain GB-1) GN=metX PE=3 SV=1 90 373 2.0E-59
sp|Q3K594|METX_PSEPF Homoserine O-acetyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=metX PE=3 SV=1 98 373 2.0E-59
sp|Q3IUE8|METX_NATPD Homoserine O-acetyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=metX PE=3 SV=1 111 382 4.0E-59
sp|Q9JZQ5|METX_NEIMB Homoserine O-acetyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=metX PE=3 SV=1 77 373 5.0E-59
sp|Q1IGC6|METX_PSEE4 Homoserine O-acetyltransferase OS=Pseudomonas entomophila (strain L48) GN=metX PE=3 SV=1 106 373 5.0E-59
sp|Q5F858|METX_NEIG1 Homoserine O-acetyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=metX PE=3 SV=1 106 373 7.0E-59
sp|Q4K4D3|METX_PSEF5 Homoserine O-acetyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metX PE=3 SV=1 98 373 9.0E-59
sp|C3K3L0|METX_PSEFS Homoserine O-acetyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=metX PE=3 SV=1 98 373 1.0E-58
sp|Q31EJ2|METX_THICR Homoserine O-acetyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=metX PE=3 SV=1 98 370 1.0E-58
sp|Q3ARA7|METX_CHLCH Homoserine O-acetyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=metX PE=3 SV=1 97 390 2.0E-58
sp|Q9JUT9|METX_NEIMA Homoserine O-acetyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=metX PE=3 SV=1 77 373 2.0E-58
sp|A1TY14|METX_MARHV Homoserine O-acetyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=metX PE=3 SV=1 98 373 4.0E-58
sp|Q81ZZ5|METX_NITEU Homoserine O-acetyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=metX PE=3 SV=1 101 373 4.0E-58
sp|A9I0E6|METX_BORPD Homoserine O-acetyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=metX PE=3 SV=1 111 373 6.0E-58
sp|A6W3E8|METX_MARMS Homoserine O-acetyltransferase OS=Marinomonas sp. (strain MWYL1) GN=metX PE=3 SV=1 106 387 2.0E-57
sp|Q6FEQ3|METX_ACIAD Homoserine O-acetyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metX PE=3 SV=1 98 373 2.0E-57
sp|A3M1Y2|METX_ACIBT Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=metX PE=3 SV=2 98 373 2.0E-57
sp|B2I3B6|METX_ACIBC Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=metX PE=3 SV=1 98 373 2.0E-57
sp|B0V4S0|METX_ACIBY Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain AYE) GN=metX PE=3 SV=1 98 373 3.0E-57
sp|B7I4X4|METX_ACIB5 Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=metX PE=3 SV=1 98 373 3.0E-57
sp|B7H098|METX_ACIB3 Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=metX PE=3 SV=1 98 373 3.0E-57
sp|Q5UY71|METX_HALMA Homoserine O-acetyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=metX PE=3 SV=1 106 510 4.0E-57
sp|B0VL51|METX_ACIBS Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain SDF) GN=metX PE=3 SV=1 98 373 1.0E-56
sp|A5CQM6|METX_CLAM3 Homoserine O-acetyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=metX PE=3 SV=1 105 375 8.0E-56
sp|Q21EI0|METX_SACD2 Homoserine O-acetyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=metX PE=3 SV=1 98 388 9.0E-56
sp|C5BLJ8|METX_TERTT Homoserine O-acetyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=metX PE=3 SV=1 106 496 2.0E-54
sp|B2HDS6|METX_MYCMM Homoserine O-acetyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=metX PE=3 SV=1 105 390 9.0E-54
sp|Q73UB0|METX_MYCPA Homoserine O-acetyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=metX PE=3 SV=1 105 509 3.0E-53
sp|A0QKL5|METX_MYCA1 Homoserine O-acetyltransferase OS=Mycobacterium avium (strain 104) GN=metX PE=3 SV=1 105 509 3.0E-53
sp|A0PNQ1|METX_MYCUA Homoserine O-acetyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=metX PE=3 SV=1 105 390 3.0E-53
sp|Q5Z1C4|METX_NOCFA Homoserine O-acetyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=metX PE=3 SV=2 106 502 4.0E-53
sp|P9WJY9|METX_MYCTU Homoserine O-acetyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metX PE=1 SV=1 105 390 5.0E-53
sp|A5U815|METX_MYCTA Homoserine O-acetyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=metX PE=3 SV=1 105 390 5.0E-53
sp|C1AHF8|METX_MYCBT Homoserine O-acetyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=metX PE=3 SV=1 105 390 5.0E-53
sp|A1KP32|METX_MYCBP Homoserine O-acetyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=metX PE=3 SV=1 105 390 5.0E-53
sp|P0A5J9|METX_MYCBO Homoserine O-acetyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=metX PE=3 SV=1 105 390 5.0E-53
sp|Q6NIZ3|METX_CORDI Homoserine O-acetyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metX PE=3 SV=1 111 510 3.0E-52
sp|P9WJY8|METX_MYCTO Homoserine O-acetyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metX PE=3 SV=1 105 390 5.0E-52
sp|Q1BCR5|METX_MYCSS Homoserine O-acetyltransferase OS=Mycobacterium sp. (strain MCS) GN=metX PE=3 SV=1 106 375 2.0E-51
sp|A1UC78|METX_MYCSK Homoserine O-acetyltransferase OS=Mycobacterium sp. (strain KMS) GN=metX PE=3 SV=1 106 375 2.0E-51
sp|O32874|METX_MYCLE Homoserine O-acetyltransferase OS=Mycobacterium leprae (strain TN) GN=metX PE=3 SV=1 105 375 7.0E-50
sp|B8ZUV9|METX_MYCLB Homoserine O-acetyltransferase OS=Mycobacterium leprae (strain Br4923) GN=metX PE=3 SV=1 105 375 7.0E-50
sp|A0QSZ0|METX_MYCS2 Homoserine O-acetyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=metX PE=3 SV=1 105 510 5.0E-48
sp|O68640|METX_CORGL Homoserine O-acetyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metX PE=1 SV=2 111 375 6.0E-48
sp|Q4JTI5|METX_CORJK Homoserine O-acetyltransferase OS=Corynebacterium jeikeium (strain K411) GN=metX PE=3 SV=1 127 509 4.0E-44
sp|P39058|CEFG_ACRCH Acetyl-CoA--deacetylcephalosporin C acetyltransferase OS=Acremonium chrysogenum GN=CEFG PE=1 SV=1 108 510 2.0E-43
sp|Q8FRT0|METX_COREF Homoserine O-acetyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metX PE=3 SV=3 111 509 2.0E-43
sp|B1VF43|METX_CORU7 Homoserine O-acetyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=metX PE=3 SV=1 129 509 1.0E-41
sp|P12917|MET2_ASCIM Homoserine O-acetyltransferase OS=Ascobolus immersus GN=MET2 PE=3 SV=1 85 336 1.0E-36
sp|P08465|MET2_YEAST Homoserine O-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET2 PE=1 SV=2 106 326 9.0E-36
sp|Q06736|MET2_SACPS Homoserine O-acetyltransferase OS=Saccharomyces pastorianus GN=MET2 PE=3 SV=1 106 326 1.0E-35
sp|Q9Y875|MET2_EMENI Homoserine O-acetyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=metE PE=3 SV=1 108 332 6.0E-34
sp|O60062|MET2_SCHPO Homoserine O-acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met6 PE=3 SV=1 108 360 3.0E-33
sp|Q9RVZ8|METX_DEIRA Homoserine O-acetyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=metX PE=3 SV=1 75 372 2.0E-27
sp|Q67NS3|METX_SYMTH Homoserine O-acetyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metX PE=3 SV=1 446 509 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6248
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7842
Ophiocordyceps australis map64 (Brazil) OphauB2|6468 (this protein)
Ophiocordyceps kimflemingae Ophio5|7198
Ophiocordyceps subramaniannii Hirsu2|7532

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6468
MASPRSVAAAVRQTSQTAFRRQAASWLQRGFHSSLLRHSEPPSPSNPAMAFPCLDAVESRSKTLSERAAAAASPA
SMASSASCSTSGPEPIYSAGPTQSYHCRDALHLDWGGVLPEYTVAYETWGTLNPQRSNAILLHTGLSASSHARST
PENPQPGWWERFIGPGAPLDTSRYFVVCTNVLGGCFGSTGPWSVDPANGERYATRFPVLTMQDMVRAQFSLLDHL
GIQTLHASVGSSMGGMQALAAGTLYPQRVGRLASISGCARSHPYSIAMRHVQRQVLMMDPNWRRGFYYDGVPPHA
GMKLARQIATVTYRSGPEWELRFGRRRADASKPPALCPDYLIETYLDHAGEKWCLSYDANSLLYVSKAMDLFDLG
AQSQRAAALRRASSPSSNQAEPVCNLTLPSAPYTEQAPSPLDSLPSSPVSLPTSPPEDLIQGLQPLHDTPTLVLG
VASDILFPSWQQREIADALRRGGNRRVTHVELSEEQSLFGHDTFLLDLDNVGGSLRRFLD*
Coding >OphauB2|6468
ATGGCGTCACCTCGATCCGTCGCAGCCGCTGTCCGCCAAACATCACAGACTGCCTTTCGACGTCAAGCAGCATCA
TGGCTGCAGCGTGGCTTCCACTCGTCTCTGCTCCGCCACTCAGAGCCCCCGTCGCCCTCCAACCCAGCCATGGCC
TTTCCATGTCTTGATGCCGTTGAATCTCGCTCCAAGACACTGTCGGAGAGAGCGGCCGCTGCAGCCTCTCCCGCA
TCCATGGCCTCGTCGGCATCATGCTCAACCTCTGGCCCTGAGCCGATTTATTCCGCCGGCCCAACACAGTCTTAC
CACTGTCGCGACGCTTTGCATCTTGACTGGGGAGGTGTGCTTCCGGAATACACAGTTGCCTATGAAACATGGGGC
ACTTTGAACCCGCAGCGCTCTAATGCCATACTACTGCATACTGGCCTCTCTGCATCCTCACATGCACGCTCAACG
CCTGAGAACCCTCAGCCTGGATGGTGGGAGCGCTTCATTGGCCCCGGCGCACCGCTTGACACGTCGCGATACTTT
GTTGTCTGTACAAATGTCTTGGGCGGCTGTTTTGGCTCCACCGGGCCTTGGAGCGTAGACCCGGCCAATGGCGAG
CGCTATGCCACTCGCTTCCCCGTCCTGACGATGCAGGACATGGTTCGCGCCCAGTTCAGCCTTTTGGACCATCTC
GGCATCCAAACTCTGCACGCGTCGGTTGGCTCAAGCATGGGTGGCATGCAGGCCTTGGCGGCGGGAACGCTCTAT
CCACAGCGCGTCGGCCGCTTGGCATCGATATCTGGCTGCGCACGCTCGCATCCCTACTCGATTGCCATGCGCCAT
GTCCAGCGCCAGGTGCTAATGATGGACCCCAACTGGCGTCGCGGCTTCTACTATGATGGAGTACCGCCCCATGCG
GGCATGAAACTGGCCCGCCAAATTGCCACTGTGACATATCGCTCCGGGCCCGAGTGGGAGCTTCGCTTTGGCCGC
CGCCGGGCAGACGCCAGCAAACCACCGGCCCTCTGTCCCGACTATCTCATTGAAACATATCTCGACCATGCAGGC
GAGAAGTGGTGTTTGAGCTATGATGCCAATAGCCTACTCTATGTTAGCAAAGCCATGGACCTGTTTGATCTTGGC
GCCCAAAGCCAGCGCGCTGCAGCTCTTCGTCGCGCCTCATCCCCAAGCTCGAACCAGGCAGAGCCAGTCTGCAAT
CTGACTCTCCCTTCTGCTCCTTACACTGAACAAGCTCCTTCACCCCTAGATTCTCTCCCCTCATCTCCGGTTTCC
CTGCCCACAAGCCCGCCTGAAGACTTGATTCAAGGCCTTCAACCACTACACGATACACCAACACTCGTTCTTGGC
GTGGCGAGCGATATTCTCTTCCCGTCATGGCAGCAGCGCGAAATTGCTGATGCATTGCGTCGCGGAGGTAATCGT
CGCGTCACGCACGTGGAGCTATCGGAGGAACAGAGTCTTTTTGGACATGATACGTTTTTGTTGGACCTTGACAAT
GTGGGTGGCAGTCTGCGCCGGTTTTTGGACTAA
Transcript >OphauB2|6468
ATGGCGTCACCTCGATCCGTCGCAGCCGCTGTCCGCCAAACATCACAGACTGCCTTTCGACGTCAAGCAGCATCA
TGGCTGCAGCGTGGCTTCCACTCGTCTCTGCTCCGCCACTCAGAGCCCCCGTCGCCCTCCAACCCAGCCATGGCC
TTTCCATGTCTTGATGCCGTTGAATCTCGCTCCAAGACACTGTCGGAGAGAGCGGCCGCTGCAGCCTCTCCCGCA
TCCATGGCCTCGTCGGCATCATGCTCAACCTCTGGCCCTGAGCCGATTTATTCCGCCGGCCCAACACAGTCTTAC
CACTGTCGCGACGCTTTGCATCTTGACTGGGGAGGTGTGCTTCCGGAATACACAGTTGCCTATGAAACATGGGGC
ACTTTGAACCCGCAGCGCTCTAATGCCATACTACTGCATACTGGCCTCTCTGCATCCTCACATGCACGCTCAACG
CCTGAGAACCCTCAGCCTGGATGGTGGGAGCGCTTCATTGGCCCCGGCGCACCGCTTGACACGTCGCGATACTTT
GTTGTCTGTACAAATGTCTTGGGCGGCTGTTTTGGCTCCACCGGGCCTTGGAGCGTAGACCCGGCCAATGGCGAG
CGCTATGCCACTCGCTTCCCCGTCCTGACGATGCAGGACATGGTTCGCGCCCAGTTCAGCCTTTTGGACCATCTC
GGCATCCAAACTCTGCACGCGTCGGTTGGCTCAAGCATGGGTGGCATGCAGGCCTTGGCGGCGGGAACGCTCTAT
CCACAGCGCGTCGGCCGCTTGGCATCGATATCTGGCTGCGCACGCTCGCATCCCTACTCGATTGCCATGCGCCAT
GTCCAGCGCCAGGTGCTAATGATGGACCCCAACTGGCGTCGCGGCTTCTACTATGATGGAGTACCGCCCCATGCG
GGCATGAAACTGGCCCGCCAAATTGCCACTGTGACATATCGCTCCGGGCCCGAGTGGGAGCTTCGCTTTGGCCGC
CGCCGGGCAGACGCCAGCAAACCACCGGCCCTCTGTCCCGACTATCTCATTGAAACATATCTCGACCATGCAGGC
GAGAAGTGGTGTTTGAGCTATGATGCCAATAGCCTACTCTATGTTAGCAAAGCCATGGACCTGTTTGATCTTGGC
GCCCAAAGCCAGCGCGCTGCAGCTCTTCGTCGCGCCTCATCCCCAAGCTCGAACCAGGCAGAGCCAGTCTGCAAT
CTGACTCTCCCTTCTGCTCCTTACACTGAACAAGCTCCTTCACCCCTAGATTCTCTCCCCTCATCTCCGGTTTCC
CTGCCCACAAGCCCGCCTGAAGACTTGATTCAAGGCCTTCAACCACTACACGATACACCAACACTCGTTCTTGGC
GTGGCGAGCGATATTCTCTTCCCGTCATGGCAGCAGCGCGAAATTGCTGATGCATTGCGTCGCGGAGGTAATCGT
CGCGTCACGCACGTGGAGCTATCGGAGGAACAGAGTCTTTTTGGACATGATACGTTTTTGTTGGACCTTGACAAT
GTGGGTGGCAGTCTGCGCCGGTTTTTGGACTAA
Gene >OphauB2|6468
ATGGCGTCACCTCGATCCGTCGCAGCCGCTGTCCGCCAAACATCACAGACTGCCTTTCGACGTCAAGCAGCATCA
TGGCTGCAGCGTGGCTTCCACTCGTCTCTGCTCCGCCACTCAGAGCCCCCGTCGCCCTCCAACCCAGCCATGGCC
TTTCCATGTCTTGATGCCGTTGAATCTCGCTCCAAGACACTGTCGGAGAGAGCGGCCGCTGCAGCCTCTCCCGCA
TCCATGGCCTCGTCGGCATCATGCTCAACCTCTGGCCCTGAGCCGATTTATTCCGCCGGCCCAACACAGTCTTAC
CACTGTCGCGACGCTTTGCATCTTGACTGGGGAGGTGTGCTTCCGGAATACACAGTTGCCTATGAAACATGGGGC
ACTTTGAACCCGCAGCGCTCTAATGCCATACTACTGCATACTGGCCTCTCTGCATCCTCACATGCACGCTCAACG
CCTGAGAACCCTCAGCCTGGATGGTGGGAGCGCTTCATTGGCCCCGGCGCACCGCTTGACACGTCGCGATACTTT
GTTGTCTGTACAAATGTCTTGGGCGGCTGTTTTGGCTCCACCGGGCCTTGGAGCGTAGACCCGGCCAATGGCGAG
CGCTATGCCACTCGCTTCCCCGTCCTGACGATGCAGGACATGGTTCGCGCCCAGTTCAGCCTTTTGGACCATCTC
GGCATCCAAACTCTGCACGCGTCGGTTGGCTCAAGCATGGGTGGCATGCAGGCCTTGGCGGCGGGAACGCTCTAT
CCACAGCGCGTCGGCCGCTTGGCATCGATATCTGGCTGCGCACGCTCGCATCCCTACTCGATTGCCATGCGCCAT
GTCCAGCGCCAGGTGCTAATGATGGACCCCAACTGGCGTCGCGGCTTCTACTATGATGGAGTACCGCCCCATGCG
GGCATGAAACTGGCCCGCCAAATTGCCACTGTGACATATCGCTCCGGGCCCGAGTGGGAGCTTCGCTTTGGCCGC
CGCCGGGCAGACGCCAGCAAACCACCGGCCCTCTGTCCCGACTATCTCATTGAAACATATCTCGACCATGCAGGC
GAGAAGTGGTGTTTGAGCTATGATGCCAATAGCCTACTCTATGTTAGCAAAGCCATGGACCTGTTTGATCTTGGC
GCCCAAAGCCAGCGCGCTGCAGCTCTTCGTCGCGCCTCATCCCCAAGCTCGAACCAGGCAGAGCCAGTCTGCAAT
CTGACTCTCCCTTCTGCTCCTTACACTGAACAAGCTCCTTCACCCCTAGATTCTCTCCCCTCATCTCCGGTTTCC
CTGCCCACAAGCCCGCCTGAAGACTTGATTCAAGGCCTTCAACCACTACACGATACACCAACACTCGTTCTTGGC
GTGGCGAGCGATATTCTCTTCCCGTCATGGCAGCAGCGCGAAATTGCTGATGCATTGCGTCGCGGAGGTAATCGT
CGCGTCACGCACGTGGAGCTATCGGAGGAACAGAGTCTTTTTGGACATGATACGTTTTTGTTGGACCTTGACAAT
GTGGGTGGCAGTCTGCGCCGGTTTTTGGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail