Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6468
Gene name
LocationContig_6:92315..93848
Strand+
Gene length (bp)1533
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 7.5E-46 133 471
PF00756 Esterase Putative esterase 8.3E-05 211 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10341|CYS2_SCHPO Probable serine-O-acetyltransferase cys2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cys2 PE=1 SV=1 45 510 0.0E+00
sp|Q2RIW8|METX_MOOTA Homoserine O-acetyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=metX PE=3 SV=1 97 374 2.0E-84
sp|Q5H124|METX_XANOR Homoserine O-acetyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=metX PE=3 SV=1 106 509 2.0E-82
sp|Q2P3Z2|METX_XANOM Homoserine O-acetyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metX PE=3 SV=1 106 509 2.0E-82
sp|Q3BSK1|METX_XANC5 Homoserine O-acetyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metX PE=3 SV=1 111 509 5.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10341|CYS2_SCHPO Probable serine-O-acetyltransferase cys2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cys2 PE=1 SV=1 45 510 0.0E+00
sp|Q2RIW8|METX_MOOTA Homoserine O-acetyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=metX PE=3 SV=1 97 374 2.0E-84
sp|Q5H124|METX_XANOR Homoserine O-acetyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=metX PE=3 SV=1 106 509 2.0E-82
sp|Q2P3Z2|METX_XANOM Homoserine O-acetyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metX PE=3 SV=1 106 509 2.0E-82
sp|Q3BSK1|METX_XANC5 Homoserine O-acetyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metX PE=3 SV=1 111 509 5.0E-82
sp|B2FMC1|METX_STRMK Homoserine O-acetyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=metX PE=3 SV=1 111 510 2.0E-80
sp|Q8PK44|METX_XANAC Homoserine O-acetyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metX PE=3 SV=1 111 509 3.0E-80
sp|Q8P8L2|METX_XANCP Homoserine O-acetyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=metX PE=3 SV=1 111 509 5.0E-78
sp|B0RS70|METX_XANCB Homoserine O-acetyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=metX PE=3 SV=1 111 509 5.0E-78
sp|Q4UVH1|METX_XANC8 Homoserine O-acetyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=metX PE=3 SV=1 111 509 5.0E-78
sp|Q9AAS1|METX_CAUCR Homoserine O-acetyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metX PE=3 SV=1 93 376 3.0E-76
sp|B8GZZ0|METX_CAUCN Homoserine O-acetyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=metX PE=3 SV=1 93 376 3.0E-76
sp|Q2RP84|METX_RHORT Homoserine O-acetyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=metX PE=3 SV=1 102 377 4.0E-75
sp|Q5NR05|METX_ZYMMO Homoserine O-acetyltransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=metX PE=3 SV=1 106 510 1.0E-74
sp|Q98G09|METX_RHILO Homoserine O-acetyltransferase OS=Rhizobium loti (strain MAFF303099) GN=metX PE=3 SV=1 96 377 3.0E-74
sp|Q1QQD3|METX_NITHX Homoserine O-acetyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=metX PE=3 SV=1 106 385 4.0E-74
sp|Q3SV39|METX_NITWN Homoserine O-acetyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=metX PE=3 SV=1 106 385 5.0E-74
sp|Q3AAW2|METX_CARHZ Homoserine O-acetyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metX PE=3 SV=1 106 374 6.0E-74
sp|Q6ANV2|METX_DESPS Homoserine O-acetyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=metX PE=3 SV=2 106 509 1.0E-73
sp|Q89UL7|METX_BRADU Homoserine O-acetyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=metX PE=3 SV=1 106 374 1.0E-73
sp|A1AUS2|METX_PELPD Homoserine O-acetyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=metX PE=3 SV=1 98 390 2.0E-72
sp|Q04RK8|METX_LEPBJ Homoserine O-acetyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=metX PE=3 SV=1 106 510 1.0E-71
sp|Q6N1G8|METX_RHOPA Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metX PE=3 SV=1 108 385 2.0E-71
sp|Q87BG9|METX_XYLFT Homoserine O-acetyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metX PE=3 SV=1 111 510 3.0E-71
sp|B2I700|METX_XYLF2 Homoserine O-acetyltransferase OS=Xylella fastidiosa (strain M23) GN=metX PE=3 SV=1 111 510 3.0E-71
sp|B9M4M5|METX_GEODF Homoserine O-acetyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=metX PE=3 SV=1 106 374 3.0E-71
sp|Q67NS3|METX_SYMTH Homoserine O-acetyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metX PE=3 SV=1 106 375 4.0E-71
sp|D2Z028|DCSE_STRLA L-serine/homoserine O-acetyltransferase OS=Streptomyces lavendulae GN=dcsE PE=1 SV=1 104 372 5.0E-71
sp|B0U3V7|METX_XYLFM Homoserine O-acetyltransferase OS=Xylella fastidiosa (strain M12) GN=metX PE=3 SV=1 111 510 5.0E-71
sp|Q3A7G2|METX_PELCD Homoserine O-acetyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=metX PE=3 SV=2 89 391 6.0E-71
sp|Q2IS70|METX_RHOP2 Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=metX PE=3 SV=1 84 385 6.0E-71
sp|Q9PAN0|METX_XYLFA Homoserine O-acetyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=metX PE=3 SV=1 111 510 8.0E-71
sp|B5EAS1|METX_GEOBB Homoserine O-acetyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=metX PE=3 SV=1 106 510 1.0E-70
sp|Q20YI1|METX_RHOPB Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=metX PE=3 SV=1 106 376 2.0E-70
sp|Q5FUF4|METX_GLUOX Homoserine O-acetyltransferase OS=Gluconobacter oxydans (strain 621H) GN=metX PE=3 SV=1 90 509 2.0E-69
sp|Q74AC8|METX_GEOSL Homoserine O-acetyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=metX PE=3 SV=1 98 374 2.0E-69
sp|Q8F4I0|METX_LEPIN Homoserine O-acetyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=metX PE=1 SV=1 106 388 6.0E-69
sp|Q72R95|METX_LEPIC Homoserine O-acetyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=metX PE=3 SV=1 106 388 6.0E-69
sp|Q052B3|METX_LEPBL Homoserine O-acetyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=metX PE=3 SV=1 106 388 6.0E-69
sp|A0LCI7|METX_MAGMM Homoserine O-acetyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=metX PE=3 SV=1 106 373 1.0E-68
sp|A5GC94|METX_GEOUR Homoserine O-acetyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=metX PE=3 SV=1 106 374 2.0E-68
sp|Q65U29|METX_MANSM Homoserine O-acetyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metX PE=3 SV=2 106 417 5.0E-68
sp|Q39RX3|METX_GEOMG Homoserine O-acetyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=metX PE=3 SV=1 98 373 1.0E-67
sp|Q47L17|METX_THEFY Homoserine O-acetyltransferase OS=Thermobifida fusca (strain YX) GN=metX PE=3 SV=1 106 389 1.0E-67
sp|A1SMU5|METX_NOCSJ Homoserine O-acetyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=metX PE=3 SV=1 104 389 1.0E-67
sp|A6SUC4|METX_JANMA Homoserine O-acetyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=metX PE=3 SV=1 98 373 2.0E-67
sp|B1YPU9|METX_BURA4 Homoserine O-acetyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=metX PE=3 SV=1 98 373 1.0E-66
sp|Q0BAW3|METX_BURCM Homoserine O-acetyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metX PE=3 SV=1 98 373 2.0E-66
sp|A9AC42|METX_BURM1 Homoserine O-acetyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=metX PE=3 SV=1 98 373 2.0E-66
sp|A5FVN0|METX_ACICJ Homoserine O-acetyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=metX PE=3 SV=1 98 376 2.0E-66
sp|A0KBH0|METX_BURCH Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=metX PE=3 SV=1 98 373 3.0E-66
sp|B1K0G8|METX_BURCC Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=metX PE=3 SV=1 98 373 3.0E-66
sp|Q1BSM1|METX_BURCA Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=metX PE=3 SV=1 98 373 3.0E-66
sp|A1KCN1|METX_AZOSB Homoserine O-acetyltransferase OS=Azoarcus sp. (strain BH72) GN=metX PE=3 SV=1 88 389 3.0E-66
sp|P94891|METX_LEPME Homoserine O-acetyltransferase OS=Leptospira meyeri GN=metX PE=3 SV=1 104 387 4.0E-66
sp|Q2T284|METX_BURTA Homoserine O-acetyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metX PE=3 SV=1 98 373 4.0E-66
sp|Q63YJ0|METX_BURPS Homoserine O-acetyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|A3N4G4|METX_BURP6 Homoserine O-acetyltransferase OS=Burkholderia pseudomallei (strain 668) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|A3NQ54|METX_BURP0 Homoserine O-acetyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|A1V7J8|METX_BURMS Homoserine O-acetyltransferase OS=Burkholderia mallei (strain SAVP1) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|Q62F07|METX_BURMA Homoserine O-acetyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|A2S877|METX_BURM9 Homoserine O-acetyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|A3MRS1|METX_BURM7 Homoserine O-acetyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=metX PE=3 SV=1 98 373 5.0E-66
sp|Q3JXB2|METX_BURP1 Homoserine O-acetyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=metX PE=3 SV=1 98 373 6.0E-66
sp|B4E7Y5|METX_BURCJ Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=metX PE=3 SV=1 98 373 6.0E-66
sp|B0SQZ8|METX_LEPBP Homoserine O-acetyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=metX PE=3 SV=1 104 387 3.0E-65
sp|B0SHJ0|METX_LEPBA Homoserine O-acetyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=metX PE=3 SV=1 104 387 3.0E-65
sp|Q4FUR4|METX_PSYA2 Homoserine O-acetyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=metX PE=3 SV=1 98 510 4.0E-65
sp|A1WVL3|METX_HALHL Homoserine O-acetyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=metX PE=3 SV=1 111 496 5.0E-65
sp|A4JIS1|METX_BURVG Homoserine O-acetyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=metX PE=3 SV=1 98 373 6.0E-65
sp|Q39BX2|METX_BURL3 Homoserine O-acetyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metX PE=3 SV=1 98 373 7.0E-65
sp|Q3B5A5|METX_CHLL7 Homoserine O-acetyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=metX PE=3 SV=1 97 509 7.0E-65
sp|A4G1K0|METX_HERAR Homoserine O-acetyltransferase OS=Herminiimonas arsenicoxydans GN=metX PE=3 SV=2 98 373 1.0E-64
sp|B3E278|METX_GEOLS Homoserine O-acetyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=metX PE=3 SV=1 98 390 1.0E-64
sp|B1XW69|METX_LEPCP Homoserine O-acetyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=metX PE=3 SV=1 98 388 2.0E-64
sp|B2IY96|METX_NOSP7 Homoserine O-acetyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=metX PE=3 SV=1 97 498 4.0E-64
sp|Q4FP51|METX_PELUB Homoserine O-acetyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=metX PE=3 SV=1 106 374 7.0E-64
sp|Q5P4R1|METX_AROAE Homoserine O-acetyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=metX PE=3 SV=1 98 373 7.0E-64
sp|B2T1N1|METX_BURPP Homoserine O-acetyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=metX PE=3 SV=1 101 373 8.0E-64
sp|P45131|METX_HAEIN Homoserine O-acetyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metX PE=1 SV=3 106 385 2.0E-63
sp|Q7W0P6|METX_BORPE Homoserine O-acetyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metX PE=3 SV=1 111 373 2.0E-63
sp|Q7WES8|METX_BORBR Homoserine O-acetyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metX PE=3 SV=1 111 373 2.0E-63
sp|Q7W3F8|METX_BORPA Homoserine O-acetyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metX PE=3 SV=1 111 373 2.0E-63
sp|B2JJW9|METX_BURP8 Homoserine O-acetyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=metX PE=3 SV=1 98 373 3.0E-63
sp|B3PFK3|METX_CELJU Homoserine O-acetyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=metX PE=3 SV=1 98 509 3.0E-63
sp|P57884|METX_PASMU Homoserine O-acetyltransferase OS=Pasteurella multocida (strain Pm70) GN=metX PE=3 SV=1 108 389 3.0E-63
sp|Q4QJY8|METX_HAEI8 Homoserine O-acetyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=metX PE=3 SV=1 106 385 4.0E-63
sp|B5ELV1|METX_ACIF5 Homoserine O-acetyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metX PE=3 SV=1 106 373 4.0E-63
sp|B7J437|METX_ACIF2 Homoserine O-acetyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=metX PE=3 SV=1 106 373 4.0E-63
sp|Q6ADB9|METX_LEIXX Homoserine O-acetyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=metX PE=3 SV=1 105 509 5.0E-63
sp|Q476W5|METX_CUPPJ Homoserine O-acetyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=metX PE=3 SV=1 98 388 6.0E-63
sp|A2SLU8|METX_METPP Homoserine O-acetyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=metX PE=3 SV=1 98 373 1.0E-62
sp|Q2YCJ2|METX_NITMU Homoserine O-acetyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=metX PE=3 SV=1 106 373 2.0E-62
sp|Q0KF58|METX_CUPNH Homoserine O-acetyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metX PE=3 SV=1 88 388 3.0E-62
sp|Q146X7|METX_BURXL Homoserine O-acetyltransferase OS=Burkholderia xenovorans (strain LB400) GN=metX PE=3 SV=1 98 373 3.0E-62
sp|Q0ABU4|METX_ALKEH Homoserine O-acetyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=metX PE=3 SV=1 98 377 3.0E-62
sp|B3QM89|METX_CHLP8 Homoserine O-acetyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=metX PE=3 SV=1 90 375 4.0E-62
sp|A6UYJ9|METX_PSEA7 Homoserine O-acetyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=metX PE=3 SV=1 98 496 6.0E-62
sp|Q47JU2|METX_DECAR Homoserine O-acetyltransferase OS=Dechloromonas aromatica (strain RCB) GN=metX PE=3 SV=1 98 373 9.0E-62
sp|Q5SK89|METX_THET8 Homoserine O-acetyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=metX PE=3 SV=1 103 509 1.0E-61
sp|Q9RA51|METX_THET2 Homoserine O-acetyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=metX PE=3 SV=2 103 509 1.0E-61
sp|C1DI67|METX_AZOVD Homoserine O-acetyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=metX PE=3 SV=1 98 373 1.0E-61
sp|Q8Y3F3|METX_RALSO Homoserine O-acetyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=metX PE=3 SV=1 101 373 1.0E-61
sp|Q1LS47|METX_CUPMC Homoserine O-acetyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metX PE=3 SV=1 98 373 3.0E-61
sp|Q3M5Q6|METX_ANAVT Homoserine O-acetyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=metX PE=3 SV=1 97 391 3.0E-61
sp|Q92E58|METX_LISIN Homoserine O-acetyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metX PE=3 SV=1 106 376 3.0E-61
sp|Q8Y9D6|METX_LISMO Homoserine O-acetyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metX PE=3 SV=1 106 376 4.0E-61
sp|C1D4Z8|METX_LARHH Homoserine O-acetyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=metX PE=3 SV=1 106 373 4.0E-61
sp|B2AGC8|METX_CUPTR Homoserine O-acetyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=metX PE=3 SV=1 88 388 5.0E-61
sp|Q722V6|METX_LISMF Homoserine O-acetyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metX PE=3 SV=1 106 376 6.0E-61
sp|Q4ZZ78|METX_PSEU2 Homoserine O-acetyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metX PE=3 SV=1 98 373 9.0E-61
sp|P57714|METX_PSEAE Homoserine O-acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metX PE=3 SV=1 98 496 1.0E-60
sp|Q02U23|METX_PSEAB Homoserine O-acetyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metX PE=3 SV=1 98 496 1.0E-60
sp|B2U7Y8|METX_RALPJ Homoserine O-acetyltransferase OS=Ralstonia pickettii (strain 12J) GN=metX PE=3 SV=1 101 388 1.0E-60
sp|P57715|METX_HALSA Homoserine O-acetyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=metX PE=3 SV=2 104 509 1.0E-60
sp|Q8KES7|METX_CHLTE Homoserine O-acetyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=metX PE=3 SV=1 97 375 2.0E-60
sp|Q2S8M0|METX_HAHCH Homoserine O-acetyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=metX PE=3 SV=1 106 373 2.0E-60
sp|B1J2H5|METX_PSEPW Homoserine O-acetyltransferase OS=Pseudomonas putida (strain W619) GN=metX PE=3 SV=1 84 373 2.0E-60
sp|A5WAD0|METX_PSEP1 Homoserine O-acetyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=metX PE=3 SV=1 84 373 2.0E-60
sp|B3QZ51|METX_CHLT3 Homoserine O-acetyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=metX PE=3 SV=1 92 374 2.0E-60
sp|B7V3X6|METX_PSEA8 Homoserine O-acetyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=metX PE=3 SV=1 98 496 3.0E-60
sp|Q0BVW2|METX_GRABC Homoserine O-acetyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=metX PE=3 SV=1 103 377 5.0E-60
sp|A4XZY6|METX_PSEMY Homoserine O-acetyltransferase OS=Pseudomonas mendocina (strain ymp) GN=metX PE=3 SV=1 85 373 5.0E-60
sp|Q7NZY3|METX_CHRVO Homoserine O-acetyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=metX PE=3 SV=1 111 373 8.0E-60
sp|Q0AIM3|METX_NITEC Homoserine O-acetyltransferase OS=Nitrosomonas eutropha (strain C91) GN=metX PE=3 SV=1 101 373 8.0E-60
sp|Q2KU63|METX_BORA1 Homoserine O-acetyltransferase OS=Bordetella avium (strain 197N) GN=metX PE=3 SV=1 69 497 1.0E-59
sp|Q87V90|METX_PSESM Homoserine O-acetyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metX PE=3 SV=1 98 373 1.0E-59
sp|A4VRJ2|METX_PSEU5 Homoserine O-acetyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=metX PE=3 SV=1 98 373 2.0E-59
sp|Q88CT3|METX_PSEPK Homoserine O-acetyltransferase OS=Pseudomonas putida (strain KT2440) GN=metX PE=3 SV=1 84 373 2.0E-59
sp|Q48PA1|METX_PSE14 Homoserine O-acetyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metX PE=3 SV=1 98 373 2.0E-59
sp|B0KN51|METX_PSEPG Homoserine O-acetyltransferase OS=Pseudomonas putida (strain GB-1) GN=metX PE=3 SV=1 90 373 2.0E-59
sp|Q3K594|METX_PSEPF Homoserine O-acetyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=metX PE=3 SV=1 98 373 2.0E-59
sp|Q3IUE8|METX_NATPD Homoserine O-acetyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=metX PE=3 SV=1 111 382 4.0E-59
sp|Q9JZQ5|METX_NEIMB Homoserine O-acetyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=metX PE=3 SV=1 77 373 5.0E-59
sp|Q1IGC6|METX_PSEE4 Homoserine O-acetyltransferase OS=Pseudomonas entomophila (strain L48) GN=metX PE=3 SV=1 106 373 5.0E-59
sp|Q5F858|METX_NEIG1 Homoserine O-acetyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=metX PE=3 SV=1 106 373 7.0E-59
sp|Q4K4D3|METX_PSEF5 Homoserine O-acetyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metX PE=3 SV=1 98 373 9.0E-59
sp|C3K3L0|METX_PSEFS Homoserine O-acetyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=metX PE=3 SV=1 98 373 1.0E-58
sp|Q31EJ2|METX_THICR Homoserine O-acetyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=metX PE=3 SV=1 98 370 1.0E-58
sp|Q3ARA7|METX_CHLCH Homoserine O-acetyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=metX PE=3 SV=1 97 390 2.0E-58
sp|Q9JUT9|METX_NEIMA Homoserine O-acetyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=metX PE=3 SV=1 77 373 2.0E-58
sp|A1TY14|METX_MARHV Homoserine O-acetyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=metX PE=3 SV=1 98 373 4.0E-58
sp|Q81ZZ5|METX_NITEU Homoserine O-acetyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=metX PE=3 SV=1 101 373 4.0E-58
sp|A9I0E6|METX_BORPD Homoserine O-acetyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=metX PE=3 SV=1 111 373 6.0E-58
sp|A6W3E8|METX_MARMS Homoserine O-acetyltransferase OS=Marinomonas sp. (strain MWYL1) GN=metX PE=3 SV=1 106 387 2.0E-57
sp|Q6FEQ3|METX_ACIAD Homoserine O-acetyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metX PE=3 SV=1 98 373 2.0E-57
sp|A3M1Y2|METX_ACIBT Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=metX PE=3 SV=2 98 373 2.0E-57
sp|B2I3B6|METX_ACIBC Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=metX PE=3 SV=1 98 373 2.0E-57
sp|B0V4S0|METX_ACIBY Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain AYE) GN=metX PE=3 SV=1 98 373 3.0E-57
sp|B7I4X4|METX_ACIB5 Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=metX PE=3 SV=1 98 373 3.0E-57
sp|B7H098|METX_ACIB3 Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=metX PE=3 SV=1 98 373 3.0E-57
sp|Q5UY71|METX_HALMA Homoserine O-acetyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=metX PE=3 SV=1 106 510 4.0E-57
sp|B0VL51|METX_ACIBS Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain SDF) GN=metX PE=3 SV=1 98 373 1.0E-56
sp|A5CQM6|METX_CLAM3 Homoserine O-acetyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=metX PE=3 SV=1 105 375 8.0E-56
sp|Q21EI0|METX_SACD2 Homoserine O-acetyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=metX PE=3 SV=1 98 388 9.0E-56
sp|C5BLJ8|METX_TERTT Homoserine O-acetyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=metX PE=3 SV=1 106 496 2.0E-54
sp|B2HDS6|METX_MYCMM Homoserine O-acetyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=metX PE=3 SV=1 105 390 9.0E-54
sp|Q73UB0|METX_MYCPA Homoserine O-acetyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=metX PE=3 SV=1 105 509 3.0E-53
sp|A0QKL5|METX_MYCA1 Homoserine O-acetyltransferase OS=Mycobacterium avium (strain 104) GN=metX PE=3 SV=1 105 509 3.0E-53
sp|A0PNQ1|METX_MYCUA Homoserine O-acetyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=metX PE=3 SV=1 105 390 3.0E-53
sp|Q5Z1C4|METX_NOCFA Homoserine O-acetyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=metX PE=3 SV=2 106 502 4.0E-53
sp|P9WJY9|METX_MYCTU Homoserine O-acetyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metX PE=1 SV=1 105 390 5.0E-53
sp|A5U815|METX_MYCTA Homoserine O-acetyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=metX PE=3 SV=1 105 390 5.0E-53
sp|C1AHF8|METX_MYCBT Homoserine O-acetyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=metX PE=3 SV=1 105 390 5.0E-53
sp|A1KP32|METX_MYCBP Homoserine O-acetyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=metX PE=3 SV=1 105 390 5.0E-53
sp|P0A5J9|METX_MYCBO Homoserine O-acetyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=metX PE=3 SV=1 105 390 5.0E-53
sp|Q6NIZ3|METX_CORDI Homoserine O-acetyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metX PE=3 SV=1 111 510 3.0E-52
sp|P9WJY8|METX_MYCTO Homoserine O-acetyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metX PE=3 SV=1 105 390 5.0E-52
sp|Q1BCR5|METX_MYCSS Homoserine O-acetyltransferase OS=Mycobacterium sp. (strain MCS) GN=metX PE=3 SV=1 106 375 2.0E-51
sp|A1UC78|METX_MYCSK Homoserine O-acetyltransferase OS=Mycobacterium sp. (strain KMS) GN=metX PE=3 SV=1 106 375 2.0E-51
sp|O32874|METX_MYCLE Homoserine O-acetyltransferase OS=Mycobacterium leprae (strain TN) GN=metX PE=3 SV=1 105 375 7.0E-50
sp|B8ZUV9|METX_MYCLB Homoserine O-acetyltransferase OS=Mycobacterium leprae (strain Br4923) GN=metX PE=3 SV=1 105 375 7.0E-50
sp|A0QSZ0|METX_MYCS2 Homoserine O-acetyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=metX PE=3 SV=1 105 510 5.0E-48
sp|O68640|METX_CORGL Homoserine O-acetyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metX PE=1 SV=2 111 375 6.0E-48
sp|Q4JTI5|METX_CORJK Homoserine O-acetyltransferase OS=Corynebacterium jeikeium (strain K411) GN=metX PE=3 SV=1 127 509 4.0E-44
sp|P39058|CEFG_ACRCH Acetyl-CoA--deacetylcephalosporin C acetyltransferase OS=Acremonium chrysogenum GN=CEFG PE=1 SV=1 108 510 2.0E-43
sp|Q8FRT0|METX_COREF Homoserine O-acetyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metX PE=3 SV=3 111 509 2.0E-43
sp|B1VF43|METX_CORU7 Homoserine O-acetyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=metX PE=3 SV=1 129 509 1.0E-41
sp|P12917|MET2_ASCIM Homoserine O-acetyltransferase OS=Ascobolus immersus GN=MET2 PE=3 SV=1 85 336 1.0E-36
sp|P08465|MET2_YEAST Homoserine O-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET2 PE=1 SV=2 106 326 9.0E-36
sp|Q06736|MET2_SACPS Homoserine O-acetyltransferase OS=Saccharomyces pastorianus GN=MET2 PE=3 SV=1 106 326 1.0E-35
sp|Q9Y875|MET2_EMENI Homoserine O-acetyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=metE PE=3 SV=1 108 332 6.0E-34
sp|O60062|MET2_SCHPO Homoserine O-acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met6 PE=3 SV=1 108 360 3.0E-33
sp|Q9RVZ8|METX_DEIRA Homoserine O-acetyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=metX PE=3 SV=1 75 372 2.0E-27
sp|Q67NS3|METX_SYMTH Homoserine O-acetyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metX PE=3 SV=1 446 509 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6468
MASPRSVAAAVRQTSQTAFRRQAASWLQRGFHSSLLRHSEPPSPSNPAMAFPCLDAVESRSKTLSERAAAAASPA
SMASSASCSTSGPEPIYSAGPTQSYHCRDALHLDWGGVLPEYTVAYETWGTLNPQRSNAILLHTGLSASSHARST
PENPQPGWWERFIGPGAPLDTSRYFVVCTNVLGGCFGSTGPWSVDPANGERYATRFPVLTMQDMVRAQFSLLDHL
GIQTLHASVGSSMGGMQALAAGTLYPQRVGRLASISGCARSHPYSIAMRHVQRQVLMMDPNWRRGFYYDGVPPHA
GMKLARQIATVTYRSGPEWELRFGRRRADASKPPALCPDYLIETYLDHAGEKWCLSYDANSLLYVSKAMDLFDLG
AQSQRAAALRRASSPSSNQAEPVCNLTLPSAPYTEQAPSPLDSLPSSPVSLPTSPPEDLIQGLQPLHDTPTLVLG
VASDILFPSWQQREIADALRRGGNRRVTHVELSEEQSLFGHDTFLLDLDNVGGSLRRFLD*
Coding >OphauB2|6468
ATGGCGTCACCTCGATCCGTCGCAGCCGCTGTCCGCCAAACATCACAGACTGCCTTTCGACGTCAAGCAGCATCA
TGGCTGCAGCGTGGCTTCCACTCGTCTCTGCTCCGCCACTCAGAGCCCCCGTCGCCCTCCAACCCAGCCATGGCC
TTTCCATGTCTTGATGCCGTTGAATCTCGCTCCAAGACACTGTCGGAGAGAGCGGCCGCTGCAGCCTCTCCCGCA
TCCATGGCCTCGTCGGCATCATGCTCAACCTCTGGCCCTGAGCCGATTTATTCCGCCGGCCCAACACAGTCTTAC
CACTGTCGCGACGCTTTGCATCTTGACTGGGGAGGTGTGCTTCCGGAATACACAGTTGCCTATGAAACATGGGGC
ACTTTGAACCCGCAGCGCTCTAATGCCATACTACTGCATACTGGCCTCTCTGCATCCTCACATGCACGCTCAACG
CCTGAGAACCCTCAGCCTGGATGGTGGGAGCGCTTCATTGGCCCCGGCGCACCGCTTGACACGTCGCGATACTTT
GTTGTCTGTACAAATGTCTTGGGCGGCTGTTTTGGCTCCACCGGGCCTTGGAGCGTAGACCCGGCCAATGGCGAG
CGCTATGCCACTCGCTTCCCCGTCCTGACGATGCAGGACATGGTTCGCGCCCAGTTCAGCCTTTTGGACCATCTC
GGCATCCAAACTCTGCACGCGTCGGTTGGCTCAAGCATGGGTGGCATGCAGGCCTTGGCGGCGGGAACGCTCTAT
CCACAGCGCGTCGGCCGCTTGGCATCGATATCTGGCTGCGCACGCTCGCATCCCTACTCGATTGCCATGCGCCAT
GTCCAGCGCCAGGTGCTAATGATGGACCCCAACTGGCGTCGCGGCTTCTACTATGATGGAGTACCGCCCCATGCG
GGCATGAAACTGGCCCGCCAAATTGCCACTGTGACATATCGCTCCGGGCCCGAGTGGGAGCTTCGCTTTGGCCGC
CGCCGGGCAGACGCCAGCAAACCACCGGCCCTCTGTCCCGACTATCTCATTGAAACATATCTCGACCATGCAGGC
GAGAAGTGGTGTTTGAGCTATGATGCCAATAGCCTACTCTATGTTAGCAAAGCCATGGACCTGTTTGATCTTGGC
GCCCAAAGCCAGCGCGCTGCAGCTCTTCGTCGCGCCTCATCCCCAAGCTCGAACCAGGCAGAGCCAGTCTGCAAT
CTGACTCTCCCTTCTGCTCCTTACACTGAACAAGCTCCTTCACCCCTAGATTCTCTCCCCTCATCTCCGGTTTCC
CTGCCCACAAGCCCGCCTGAAGACTTGATTCAAGGCCTTCAACCACTACACGATACACCAACACTCGTTCTTGGC
GTGGCGAGCGATATTCTCTTCCCGTCATGGCAGCAGCGCGAAATTGCTGATGCATTGCGTCGCGGAGGTAATCGT
CGCGTCACGCACGTGGAGCTATCGGAGGAACAGAGTCTTTTTGGACATGATACGTTTTTGTTGGACCTTGACAAT
GTGGGTGGCAGTCTGCGCCGGTTTTTGGACTAA
Transcript >OphauB2|6468
ATGGCGTCACCTCGATCCGTCGCAGCCGCTGTCCGCCAAACATCACAGACTGCCTTTCGACGTCAAGCAGCATCA
TGGCTGCAGCGTGGCTTCCACTCGTCTCTGCTCCGCCACTCAGAGCCCCCGTCGCCCTCCAACCCAGCCATGGCC
TTTCCATGTCTTGATGCCGTTGAATCTCGCTCCAAGACACTGTCGGAGAGAGCGGCCGCTGCAGCCTCTCCCGCA
TCCATGGCCTCGTCGGCATCATGCTCAACCTCTGGCCCTGAGCCGATTTATTCCGCCGGCCCAACACAGTCTTAC
CACTGTCGCGACGCTTTGCATCTTGACTGGGGAGGTGTGCTTCCGGAATACACAGTTGCCTATGAAACATGGGGC
ACTTTGAACCCGCAGCGCTCTAATGCCATACTACTGCATACTGGCCTCTCTGCATCCTCACATGCACGCTCAACG
CCTGAGAACCCTCAGCCTGGATGGTGGGAGCGCTTCATTGGCCCCGGCGCACCGCTTGACACGTCGCGATACTTT
GTTGTCTGTACAAATGTCTTGGGCGGCTGTTTTGGCTCCACCGGGCCTTGGAGCGTAGACCCGGCCAATGGCGAG
CGCTATGCCACTCGCTTCCCCGTCCTGACGATGCAGGACATGGTTCGCGCCCAGTTCAGCCTTTTGGACCATCTC
GGCATCCAAACTCTGCACGCGTCGGTTGGCTCAAGCATGGGTGGCATGCAGGCCTTGGCGGCGGGAACGCTCTAT
CCACAGCGCGTCGGCCGCTTGGCATCGATATCTGGCTGCGCACGCTCGCATCCCTACTCGATTGCCATGCGCCAT
GTCCAGCGCCAGGTGCTAATGATGGACCCCAACTGGCGTCGCGGCTTCTACTATGATGGAGTACCGCCCCATGCG
GGCATGAAACTGGCCCGCCAAATTGCCACTGTGACATATCGCTCCGGGCCCGAGTGGGAGCTTCGCTTTGGCCGC
CGCCGGGCAGACGCCAGCAAACCACCGGCCCTCTGTCCCGACTATCTCATTGAAACATATCTCGACCATGCAGGC
GAGAAGTGGTGTTTGAGCTATGATGCCAATAGCCTACTCTATGTTAGCAAAGCCATGGACCTGTTTGATCTTGGC
GCCCAAAGCCAGCGCGCTGCAGCTCTTCGTCGCGCCTCATCCCCAAGCTCGAACCAGGCAGAGCCAGTCTGCAAT
CTGACTCTCCCTTCTGCTCCTTACACTGAACAAGCTCCTTCACCCCTAGATTCTCTCCCCTCATCTCCGGTTTCC
CTGCCCACAAGCCCGCCTGAAGACTTGATTCAAGGCCTTCAACCACTACACGATACACCAACACTCGTTCTTGGC
GTGGCGAGCGATATTCTCTTCCCGTCATGGCAGCAGCGCGAAATTGCTGATGCATTGCGTCGCGGAGGTAATCGT
CGCGTCACGCACGTGGAGCTATCGGAGGAACAGAGTCTTTTTGGACATGATACGTTTTTGTTGGACCTTGACAAT
GTGGGTGGCAGTCTGCGCCGGTTTTTGGACTAA
Gene >OphauB2|6468
ATGGCGTCACCTCGATCCGTCGCAGCCGCTGTCCGCCAAACATCACAGACTGCCTTTCGACGTCAAGCAGCATCA
TGGCTGCAGCGTGGCTTCCACTCGTCTCTGCTCCGCCACTCAGAGCCCCCGTCGCCCTCCAACCCAGCCATGGCC
TTTCCATGTCTTGATGCCGTTGAATCTCGCTCCAAGACACTGTCGGAGAGAGCGGCCGCTGCAGCCTCTCCCGCA
TCCATGGCCTCGTCGGCATCATGCTCAACCTCTGGCCCTGAGCCGATTTATTCCGCCGGCCCAACACAGTCTTAC
CACTGTCGCGACGCTTTGCATCTTGACTGGGGAGGTGTGCTTCCGGAATACACAGTTGCCTATGAAACATGGGGC
ACTTTGAACCCGCAGCGCTCTAATGCCATACTACTGCATACTGGCCTCTCTGCATCCTCACATGCACGCTCAACG
CCTGAGAACCCTCAGCCTGGATGGTGGGAGCGCTTCATTGGCCCCGGCGCACCGCTTGACACGTCGCGATACTTT
GTTGTCTGTACAAATGTCTTGGGCGGCTGTTTTGGCTCCACCGGGCCTTGGAGCGTAGACCCGGCCAATGGCGAG
CGCTATGCCACTCGCTTCCCCGTCCTGACGATGCAGGACATGGTTCGCGCCCAGTTCAGCCTTTTGGACCATCTC
GGCATCCAAACTCTGCACGCGTCGGTTGGCTCAAGCATGGGTGGCATGCAGGCCTTGGCGGCGGGAACGCTCTAT
CCACAGCGCGTCGGCCGCTTGGCATCGATATCTGGCTGCGCACGCTCGCATCCCTACTCGATTGCCATGCGCCAT
GTCCAGCGCCAGGTGCTAATGATGGACCCCAACTGGCGTCGCGGCTTCTACTATGATGGAGTACCGCCCCATGCG
GGCATGAAACTGGCCCGCCAAATTGCCACTGTGACATATCGCTCCGGGCCCGAGTGGGAGCTTCGCTTTGGCCGC
CGCCGGGCAGACGCCAGCAAACCACCGGCCCTCTGTCCCGACTATCTCATTGAAACATATCTCGACCATGCAGGC
GAGAAGTGGTGTTTGAGCTATGATGCCAATAGCCTACTCTATGTTAGCAAAGCCATGGACCTGTTTGATCTTGGC
GCCCAAAGCCAGCGCGCTGCAGCTCTTCGTCGCGCCTCATCCCCAAGCTCGAACCAGGCAGAGCCAGTCTGCAAT
CTGACTCTCCCTTCTGCTCCTTACACTGAACAAGCTCCTTCACCCCTAGATTCTCTCCCCTCATCTCCGGTTTCC
CTGCCCACAAGCCCGCCTGAAGACTTGATTCAAGGCCTTCAACCACTACACGATACACCAACACTCGTTCTTGGC
GTGGCGAGCGATATTCTCTTCCCGTCATGGCAGCAGCGCGAAATTGCTGATGCATTGCGTCGCGGAGGTAATCGT
CGCGTCACGCACGTGGAGCTATCGGAGGAACAGAGTCTTTTTGGACATGATACGTTTTTGTTGGACCTTGACAAT
GTGGGTGGCAGTCTGCGCCGGTTTTTGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail