Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6465
Gene name
LocationContig_6:77916..79173
Strand+
Gene length (bp)1257
Transcript length (bp)1257
Coding sequence length (bp)1257
Protein length (aa) 419

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06027 SLC35F Solute carrier family 35 7.9E-94 70 367
PF08627 CRT-like CRT-like, chloroquine-resistance transporter-like 9.8E-08 137 306

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59785|YCN8_SCHPO Uncharacterized solute carrier family 35 member C320.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.08 PE=1 SV=1 67 397 3.0E-97
sp|Q5T1Q4|S35F1_HUMAN Solute carrier family 35 member F1 OS=Homo sapiens GN=SLC35F1 PE=2 SV=2 68 366 3.0E-55
sp|Q8BGK5|S35F1_MOUSE Solute carrier family 35 member F1 OS=Mus musculus GN=Slc35f1 PE=1 SV=1 68 366 2.0E-54
sp|Q8IXU6|S35F2_HUMAN Solute carrier family 35 member F2 OS=Homo sapiens GN=SLC35F2 PE=1 SV=1 68 366 4.0E-52
sp|Q7TML3|S35F2_MOUSE Solute carrier family 35 member F2 OS=Mus musculus GN=Slc35f2 PE=1 SV=2 54 366 5.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59785|YCN8_SCHPO Uncharacterized solute carrier family 35 member C320.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.08 PE=1 SV=1 67 397 3.0E-97
sp|Q5T1Q4|S35F1_HUMAN Solute carrier family 35 member F1 OS=Homo sapiens GN=SLC35F1 PE=2 SV=2 68 366 3.0E-55
sp|Q8BGK5|S35F1_MOUSE Solute carrier family 35 member F1 OS=Mus musculus GN=Slc35f1 PE=1 SV=1 68 366 2.0E-54
sp|Q8IXU6|S35F2_HUMAN Solute carrier family 35 member F2 OS=Homo sapiens GN=SLC35F2 PE=1 SV=1 68 366 4.0E-52
sp|Q7TML3|S35F2_MOUSE Solute carrier family 35 member F2 OS=Mus musculus GN=Slc35f2 PE=1 SV=2 54 366 5.0E-52
sp|Q0V9U2|S35F2_XENTR Solute carrier family 35 member F2 OS=Xenopus tropicalis GN=slc35f2 PE=2 SV=2 41 367 7.0E-48
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 104 126 22
3 145 167 22
4 172 191 19
5 198 217 19
6 232 254 22
7 261 280 19
8 295 317 22
9 324 346 22
10 351 373 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6465
MTIEHQNNDHKGGFDQSLTASRSEASAVARSSTRASDDATQQWPDDALDASRGLDMLESRSSHWYSYLVTRNFWI
LLLIGQVLALCITATNTFTSFLAEAHFDAPAFQSLLNYALLAVLFNTLFLVRDGPRAWYKAARTDGWRYLIMAFL
DVEGNYFTVLAYQYTNILSAQLLNFWSIVVVVTTSFFLLRVRYRWCQVVGILVACAGMGILLASDHIQNRNGGPA
ANALKGDLFGLLGASLYGASNVLEEYLVSRKPMHHVLAFISLLGVIISAVHAAIFDRHALAHAPWSQSSVPAYLV
GYTLCLSLFYTLAPLILRMGSAAFFDISLLTANFWGVIIGVRVFGYAIHFLYPIAFVCIVSGLVVYFLSGSVLGD
SRKPWLGQNQEAGVAGIGTAKRRAIRIARAAPAEPEHGVQPST*
Coding >OphauB2|6465
ATGACTATCGAGCATCAAAATAATGACCACAAGGGCGGCTTCGACCAATCCCTCACTGCCAGCCGCTCCGAAGCC
TCGGCCGTGGCGCGCTCCAGCACTCGAGCCAGCGACGATGCGACGCAGCAATGGCCCGACGATGCCCTCGACGCT
AGCCGCGGCCTCGACATGCTCGAGTCGCGCTCTTCACACTGGTATAGCTACCTGGTGACGCGCAACTTTTGGATT
CTTCTTCTCATTGGCCAGGTGCTCGCCTTGTGCATCACGGCCACGAATACCTTTACCTCGTTCCTCGCAGAGGCT
CATTTTGACGCTCCGGCCTTTCAGTCCCTGCTCAACTATGCGCTGCTCGCTGTCCTCTTCAACACGCTCTTCCTC
GTCCGCGACGGCCCCAGAGCTTGGTACAAGGCGGCACGCACAGATGGCTGGCGTTATCTCATCATGGCCTTTCTC
GACGTCGAGGGCAACTACTTCACCGTCCTTGCATACCAATACACAAATATCTTGTCGGCACAGCTCCTCAACTTT
TGGTCCATTGTCGTTGTCGTCACCACATCCTTCTTCCTCTTGCGCGTGAGATACCGCTGGTGTCAGGTTGTTGGC
ATTCTTGTCGCCTGCGCTGGAATGGGCATTCTTCTCGCCTCGGACCACATCCAGAATCGAAACGGCGGCCCCGCC
GCAAATGCCCTCAAGGGTGATCTCTTTGGCCTCTTGGGCGCCAGTCTTTACGGCGCCTCCAACGTCTTGGAAGAG
TATCTAGTGTCTCGCAAGCCAATGCATCACGTTCTTGCCTTTATTTCTCTTCTCGGTGTCATCATCTCGGCCGTC
CACGCCGCAATCTTTGACCGCCACGCTCTCGCTCATGCCCCGTGGTCCCAGTCCTCGGTCCCAGCCTATCTGGTT
GGCTACACCCTCTGTCTCTCCCTTTTTTATACCCTGGCACCCCTCATCCTCCGCATGGGCTCCGCCGCCTTTTTC
GACATTTCGTTGCTCACAGCCAACTTTTGGGGCGTCATTATAGGCGTCCGCGTTTTTGGATATGCTATCCACTTT
TTATACCCCATTGCATTTGTCTGCATCGTCTCTGGGCTTGTTGTCTATTTTCTCTCTGGTTCTGTGCTTGGCGAC
TCGCGCAAGCCCTGGCTGGGTCAAAATCAAGAAGCTGGAGTCGCAGGCATTGGCACTGCCAAGCGCCGTGCTATC
CGCATAGCTCGCGCCGCCCCAGCTGAGCCTGAACACGGCGTTCAACCGTCGACTTAG
Transcript >OphauB2|6465
ATGACTATCGAGCATCAAAATAATGACCACAAGGGCGGCTTCGACCAATCCCTCACTGCCAGCCGCTCCGAAGCC
TCGGCCGTGGCGCGCTCCAGCACTCGAGCCAGCGACGATGCGACGCAGCAATGGCCCGACGATGCCCTCGACGCT
AGCCGCGGCCTCGACATGCTCGAGTCGCGCTCTTCACACTGGTATAGCTACCTGGTGACGCGCAACTTTTGGATT
CTTCTTCTCATTGGCCAGGTGCTCGCCTTGTGCATCACGGCCACGAATACCTTTACCTCGTTCCTCGCAGAGGCT
CATTTTGACGCTCCGGCCTTTCAGTCCCTGCTCAACTATGCGCTGCTCGCTGTCCTCTTCAACACGCTCTTCCTC
GTCCGCGACGGCCCCAGAGCTTGGTACAAGGCGGCACGCACAGATGGCTGGCGTTATCTCATCATGGCCTTTCTC
GACGTCGAGGGCAACTACTTCACCGTCCTTGCATACCAATACACAAATATCTTGTCGGCACAGCTCCTCAACTTT
TGGTCCATTGTCGTTGTCGTCACCACATCCTTCTTCCTCTTGCGCGTGAGATACCGCTGGTGTCAGGTTGTTGGC
ATTCTTGTCGCCTGCGCTGGAATGGGCATTCTTCTCGCCTCGGACCACATCCAGAATCGAAACGGCGGCCCCGCC
GCAAATGCCCTCAAGGGTGATCTCTTTGGCCTCTTGGGCGCCAGTCTTTACGGCGCCTCCAACGTCTTGGAAGAG
TATCTAGTGTCTCGCAAGCCAATGCATCACGTTCTTGCCTTTATTTCTCTTCTCGGTGTCATCATCTCGGCCGTC
CACGCCGCAATCTTTGACCGCCACGCTCTCGCTCATGCCCCGTGGTCCCAGTCCTCGGTCCCAGCCTATCTGGTT
GGCTACACCCTCTGTCTCTCCCTTTTTTATACCCTGGCACCCCTCATCCTCCGCATGGGCTCCGCCGCCTTTTTC
GACATTTCGTTGCTCACAGCCAACTTTTGGGGCGTCATTATAGGCGTCCGCGTTTTTGGATATGCTATCCACTTT
TTATACCCCATTGCATTTGTCTGCATCGTCTCTGGGCTTGTTGTCTATTTTCTCTCTGGTTCTGTGCTTGGCGAC
TCGCGCAAGCCCTGGCTGGGTCAAAATCAAGAAGCTGGAGTCGCAGGCATTGGCACTGCCAAGCGCCGTGCTATC
CGCATAGCTCGCGCCGCCCCAGCTGAGCCTGAACACGGCGTTCAACCGTCGACTTAG
Gene >OphauB2|6465
ATGACTATCGAGCATCAAAATAATGACCACAAGGGCGGCTTCGACCAATCCCTCACTGCCAGCCGCTCCGAAGCC
TCGGCCGTGGCGCGCTCCAGCACTCGAGCCAGCGACGATGCGACGCAGCAATGGCCCGACGATGCCCTCGACGCT
AGCCGCGGCCTCGACATGCTCGAGTCGCGCTCTTCACACTGGTATAGCTACCTGGTGACGCGCAACTTTTGGATT
CTTCTTCTCATTGGCCAGGTGCTCGCCTTGTGCATCACGGCCACGAATACCTTTACCTCGTTCCTCGCAGAGGCT
CATTTTGACGCTCCGGCCTTTCAGTCCCTGCTCAACTATGCGCTGCTCGCTGTCCTCTTCAACACGCTCTTCCTC
GTCCGCGACGGCCCCAGAGCTTGGTACAAGGCGGCACGCACAGATGGCTGGCGTTATCTCATCATGGCCTTTCTC
GACGTCGAGGGCAACTACTTCACCGTCCTTGCATACCAATACACAAATATCTTGTCGGCACAGCTCCTCAACTTT
TGGTCCATTGTCGTTGTCGTCACCACATCCTTCTTCCTCTTGCGCGTGAGATACCGCTGGTGTCAGGTTGTTGGC
ATTCTTGTCGCCTGCGCTGGAATGGGCATTCTTCTCGCCTCGGACCACATCCAGAATCGAAACGGCGGCCCCGCC
GCAAATGCCCTCAAGGGTGATCTCTTTGGCCTCTTGGGCGCCAGTCTTTACGGCGCCTCCAACGTCTTGGAAGAG
TATCTAGTGTCTCGCAAGCCAATGCATCACGTTCTTGCCTTTATTTCTCTTCTCGGTGTCATCATCTCGGCCGTC
CACGCCGCAATCTTTGACCGCCACGCTCTCGCTCATGCCCCGTGGTCCCAGTCCTCGGTCCCAGCCTATCTGGTT
GGCTACACCCTCTGTCTCTCCCTTTTTTATACCCTGGCACCCCTCATCCTCCGCATGGGCTCCGCCGCCTTTTTC
GACATTTCGTTGCTCACAGCCAACTTTTGGGGCGTCATTATAGGCGTCCGCGTTTTTGGATATGCTATCCACTTT
TTATACCCCATTGCATTTGTCTGCATCGTCTCTGGGCTTGTTGTCTATTTTCTCTCTGGTTCTGTGCTTGGCGAC
TCGCGCAAGCCCTGGCTGGGTCAAAATCAAGAAGCTGGAGTCGCAGGCATTGGCACTGCCAAGCGCCGTGCTATC
CGCATAGCTCGCGCCGCCCCAGCTGAGCCTGAACACGGCGTTCAACCGTCGACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail