Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6463
Gene name
LocationContig_6:71851..74859
Strand+
Gene length (bp)3008
Transcript length (bp)2937
Coding sequence length (bp)2937
Protein length (aa) 979

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07774 EMC1_C ER membrane protein complex subunit 1, C-terminal 4.4E-65 743 974
PF13360 PQQ_2 PQQ-like domain 6.3E-16 65 324

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NRB9|EMC1_XENLA ER membrane protein complex subunit 1 OS=Xenopus laevis GN=emc1 PE=2 SV=1 408 974 8.0E-41
sp|P25574|EMC1_YEAST ER membrane protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC1 PE=1 SV=1 421 974 9.0E-41
sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 421 974 4.0E-37
sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 421 974 2.0E-36
sp|Q5ZL00|EMC1_CHICK ER membrane protein complex subunit 1 OS=Gallus gallus GN=EMC1 PE=2 SV=1 629 974 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NRB9|EMC1_XENLA ER membrane protein complex subunit 1 OS=Xenopus laevis GN=emc1 PE=2 SV=1 408 974 8.0E-41
sp|P25574|EMC1_YEAST ER membrane protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC1 PE=1 SV=1 421 974 9.0E-41
sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 421 974 4.0E-37
sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 421 974 2.0E-36
sp|Q5ZL00|EMC1_CHICK ER membrane protein complex subunit 1 OS=Gallus gallus GN=EMC1 PE=2 SV=1 629 974 1.0E-35
sp|Q8C7X2|EMC1_MOUSE ER membrane protein complex subunit 1 OS=Mus musculus GN=Emc1 PE=1 SV=1 421 974 1.0E-34
sp|O13981|EMC1_SCHPO ER membrane protein complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emc1 PE=3 SV=1 416 974 5.0E-30
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 945 964 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6463
MRQSLHSALLLGLCAFGGAIFQDEVGDVDFHYALLGHPQPETTFFHRPRRDDRASLLYTLSDIGILGAVNPSNGD
LIWRHEVVKNATSGDKSFLRAPDGDDWVVAAHGSAVSAWNALTGRNVWHMEFSERIRDVEILQMTETSHRDVLVL
FDDEGVTVLRRLHGTLGSVVWEFRDTRGHSPLQVSNDVTHVFAIGLEGAAPSYSLRIVSLDVATGSLVDVWSVGS
KDEIQTPQDVMFVGANSAAPIVAWTDPGLSKLSINALGSRSKQDFHLPPDTMAVNIHAPHLAQSQTHFLVHIKTQ
PESLGGEEENKALVFHTDIKTGQIKLAYELPHFRGKGTFATSSDGANVYFVQIGEEETLVVSSDSHGILARWPNP
KAAPIAPICAVAEVVKKPTGQDVALRQAVFTANEDWVLVRNGERYWTRHEGLSDSVAAVWAEIPRGQDLAKVLAE
EAHTSPLAAYTHRVKRHIHDLQYLPAWLADIPSRVIESMVGDGGGDKKTTGLYRDSFGFNKILVVGTRRGRFYGL
DAANGGRVLWTQSWFPRETQHPLVIKGLSAVDEEGSVVMYGADGEYVVFNASTGAVREHVVGGAKVSATAEFDAS
LGKKTVLPIGSNGLPTRALPLGWKSEQTIVIVEDGVVRGVKYRHDEGKTTRHDMWQLQLFARQRILQIATPPRHD
PIASVGRVLGDRRVMYKYLDANALVVAAIDDATHLVSIRLVDGVSGQVLAAHEYPGVDASQPVSCTMAENWYACA
FFATYPVGARSIQGHHLVVADLYESPLPNDRGPWGDDAATNSSALLPLDSPLAAAPPLPHVVAQAFVVSEPLAAL
CVSQTRQGITTRQLNAYLPASHALVGLPRPIIDPRRPVGRDPSAADVEAEGLMRYTPALEIDPRSVFSHQRDVLR
IRALVPAPTLVESTSLLAAIGTDVYVARLAPSGVFDILGKGFNKTSLLATVLALLAGVLFLRPLVRRKQIDRRWE
AFL*
Coding >OphauB2|6463
ATGCGACAATCACTGCATTCGGCCCTGCTGCTGGGCCTGTGCGCCTTTGGTGGTGCCATATTCCAGGATGAAGTG
GGAGACGTGGACTTTCATTACGCTTTGCTTGGCCACCCGCAGCCCGAAACGACATTTTTCCACCGCCCCAGACGA
GACGATCGAGCCAGCTTGTTATACACGCTCAGCGACATTGGCATTCTTGGCGCGGTGAATCCAAGCAACGGGGAC
CTGATATGGCGGCATGAGGTTGTCAAGAATGCGACAAGTGGCGACAAGAGCTTTTTGCGGGCGCCTGATGGCGAC
GATTGGGTGGTGGCTGCCCACGGCTCTGCAGTGTCGGCGTGGAATGCGCTGACGGGGCGCAACGTGTGGCACATG
GAGTTTAGCGAAAGGATACGAGACGTTGAGATTTTGCAAATGACGGAAACGTCACACAGGGATGTCTTGGTGCTG
TTTGATGACGAGGGCGTGACCGTCTTGAGAAGGCTGCACGGTACTCTTGGCTCCGTTGTTTGGGAATTCCGCGAT
ACAAGAGGTCATTCGCCGCTTCAAGTGTCCAACGACGTGACGCATGTCTTTGCCATTGGACTGGAGGGAGCGGCG
CCTTCCTATAGTCTCCGAATTGTGTCGCTGGACGTGGCAACGGGCAGCCTTGTCGACGTCTGGTCTGTGGGTTCC
AAGGACGAGATTCAGACGCCTCAAGATGTAATGTTTGTTGGTGCCAACTCTGCAGCTCCCATTGTGGCGTGGACG
GACCCTGGACTATCCAAGCTGAGCATCAATGCGCTGGGCAGCCGGTCAAAGCAAGACTTTCACCTCCCACCAGAC
ACCATGGCGGTCAATATTCACGCGCCGCACCTCGCGCAGTCACAAACTCACTTCTTGGTGCACATCAAGACGCAG
CCTGAATCGCTGGGCGGCGAGGAGGAGAACAAGGCCTTGGTGTTTCACACGGACATCAAGACGGGGCAAATCAAG
CTTGCTTACGAACTGCCTCACTTTCGCGGCAAGGGCACCTTTGCGACGAGCTCTGATGGGGCAAATGTCTACTTT
GTGCAGATTGGCGAGGAGGAGACGCTAGTCGTATCGTCGGATTCACATGGCATTCTGGCCCGCTGGCCGAATCCC
AAGGCTGCCCCCATTGCCCCGATATGTGCCGTTGCAGAGGTGGTCAAGAAGCCGACTGGACAAGACGTTGCTCTG
CGCCAGGCAGTCTTTACCGCCAATGAAGACTGGGTCTTGGTACGAAATGGCGAGCGCTACTGGACGCGACACGAG
GGCCTGTCCGACTCTGTGGCGGCAGTGTGGGCCGAGATTCCAAGAGGACAAGACTTGGCCAAGGTGCTGGCTGAA
GAAGCACACACGAGCCCCCTTGCGGCGTATACGCATCGCGTGAAGCGCCATATCCACGACTTGCAGTACCTCCCC
GCATGGCTTGCTGATATCCCGTCGCGAGTGATTGAGAGCATGGTGGGCGATGGCGGCGGCGACAAGAAGACGACG
GGTCTTTATCGAGACAGTTTTGGATTCAACAAGATTCTCGTGGTTGGCACGCGTCGCGGGCGCTTTTACGGGCTG
GATGCCGCCAATGGGGGACGAGTGCTGTGGACGCAGAGCTGGTTTCCTCGCGAGACGCAGCATCCGCTCGTCATC
AAGGGCCTCTCTGCCGTGGACGAGGAAGGAAGTGTCGTCATGTACGGCGCCGACGGCGAGTATGTTGTCTTTAAT
GCCAGTACCGGAGCTGTGCGGGAGCATGTGGTGGGCGGCGCCAAAGTCTCCGCCACGGCAGAGTTTGATGCGAGC
TTGGGCAAAAAGACGGTGCTTCCAATCGGCAGCAATGGCCTGCCGACTCGTGCGCTGCCTCTAGGATGGAAGAGC
GAGCAGACAATTGTTATAGTCGAAGATGGAGTCGTACGGGGTGTAAAGTACCGCCACGACGAGGGCAAGACGACT
AGACACGACATGTGGCAGCTGCAGCTCTTTGCGCGCCAACGCATCCTCCAAATCGCCACACCACCCCGTCACGAC
CCCATTGCCTCGGTTGGCCGCGTCCTCGGCGACCGGCGCGTCATGTACAAGTACCTCGATGCAAACGCCCTCGTC
GTGGCCGCCATTGACGACGCCACCCACCTCGTTTCCATTCGCCTCGTTGACGGCGTCTCGGGCCAAGTCCTTGCC
GCGCACGAGTATCCCGGCGTCGACGCCTCGCAGCCCGTGTCGTGCACCATGGCGGAAAACTGGTATGCCTGCGCC
TTCTTCGCCACATACCCCGTCGGCGCCCGCTCCATCCAGGGCCACCACCTCGTCGTGGCAGACCTTTACGAATCC
CCCCTGCCAAACGACCGCGGGCCCTGGGGCGACGACGCCGCCACCAACTCGTCGGCCCTGCTGCCTCTAGACTCG
CCGCTTGCTGCCGCGCCGCCCCTGCCGCACGTTGTTGCCCAAGCCTTTGTCGTGTCGGAGCCCCTCGCCGCGCTG
TGCGTCTCCCAGACGCGCCAGGGCATCACCACGCGCCAGCTAAACGCCTACCTGCCCGCCTCGCACGCCCTCGTT
GGCCTGCCCCGGCCCATTATCGATCCGCGGCGTCCAGTCGGCCGCGACCCCTCGGCGGCAGATGTCGAGGCTGAG
GGTCTCATGCGCTACACGCCCGCTCTGGAAATCGACCCGCGGTCCGTCTTTTCCCATCAGCGCGACGTGCTGCGC
ATACGTGCTCTTGTGCCGGCGCCCACGCTTGTTGAGAGTACCTCGTTGCTCGCCGCCATTGGCACAGACGTCTAC
GTTGCGCGCCTCGCGCCAAGTGGCGTGTTTGACATTCTCGGAAAGGGTTTCAATAAAACCTCCCTCTTGGCAACC
GTTCTTGCCCTCTTGGCAGGAGTCTTGTTTCTACGGCCACTGGTCCGAAGAAAACAAATCGACCGTCGATGGGAG
GCCTTTCTCTAA
Transcript >OphauB2|6463
ATGCGACAATCACTGCATTCGGCCCTGCTGCTGGGCCTGTGCGCCTTTGGTGGTGCCATATTCCAGGATGAAGTG
GGAGACGTGGACTTTCATTACGCTTTGCTTGGCCACCCGCAGCCCGAAACGACATTTTTCCACCGCCCCAGACGA
GACGATCGAGCCAGCTTGTTATACACGCTCAGCGACATTGGCATTCTTGGCGCGGTGAATCCAAGCAACGGGGAC
CTGATATGGCGGCATGAGGTTGTCAAGAATGCGACAAGTGGCGACAAGAGCTTTTTGCGGGCGCCTGATGGCGAC
GATTGGGTGGTGGCTGCCCACGGCTCTGCAGTGTCGGCGTGGAATGCGCTGACGGGGCGCAACGTGTGGCACATG
GAGTTTAGCGAAAGGATACGAGACGTTGAGATTTTGCAAATGACGGAAACGTCACACAGGGATGTCTTGGTGCTG
TTTGATGACGAGGGCGTGACCGTCTTGAGAAGGCTGCACGGTACTCTTGGCTCCGTTGTTTGGGAATTCCGCGAT
ACAAGAGGTCATTCGCCGCTTCAAGTGTCCAACGACGTGACGCATGTCTTTGCCATTGGACTGGAGGGAGCGGCG
CCTTCCTATAGTCTCCGAATTGTGTCGCTGGACGTGGCAACGGGCAGCCTTGTCGACGTCTGGTCTGTGGGTTCC
AAGGACGAGATTCAGACGCCTCAAGATGTAATGTTTGTTGGTGCCAACTCTGCAGCTCCCATTGTGGCGTGGACG
GACCCTGGACTATCCAAGCTGAGCATCAATGCGCTGGGCAGCCGGTCAAAGCAAGACTTTCACCTCCCACCAGAC
ACCATGGCGGTCAATATTCACGCGCCGCACCTCGCGCAGTCACAAACTCACTTCTTGGTGCACATCAAGACGCAG
CCTGAATCGCTGGGCGGCGAGGAGGAGAACAAGGCCTTGGTGTTTCACACGGACATCAAGACGGGGCAAATCAAG
CTTGCTTACGAACTGCCTCACTTTCGCGGCAAGGGCACCTTTGCGACGAGCTCTGATGGGGCAAATGTCTACTTT
GTGCAGATTGGCGAGGAGGAGACGCTAGTCGTATCGTCGGATTCACATGGCATTCTGGCCCGCTGGCCGAATCCC
AAGGCTGCCCCCATTGCCCCGATATGTGCCGTTGCAGAGGTGGTCAAGAAGCCGACTGGACAAGACGTTGCTCTG
CGCCAGGCAGTCTTTACCGCCAATGAAGACTGGGTCTTGGTACGAAATGGCGAGCGCTACTGGACGCGACACGAG
GGCCTGTCCGACTCTGTGGCGGCAGTGTGGGCCGAGATTCCAAGAGGACAAGACTTGGCCAAGGTGCTGGCTGAA
GAAGCACACACGAGCCCCCTTGCGGCGTATACGCATCGCGTGAAGCGCCATATCCACGACTTGCAGTACCTCCCC
GCATGGCTTGCTGATATCCCGTCGCGAGTGATTGAGAGCATGGTGGGCGATGGCGGCGGCGACAAGAAGACGACG
GGTCTTTATCGAGACAGTTTTGGATTCAACAAGATTCTCGTGGTTGGCACGCGTCGCGGGCGCTTTTACGGGCTG
GATGCCGCCAATGGGGGACGAGTGCTGTGGACGCAGAGCTGGTTTCCTCGCGAGACGCAGCATCCGCTCGTCATC
AAGGGCCTCTCTGCCGTGGACGAGGAAGGAAGTGTCGTCATGTACGGCGCCGACGGCGAGTATGTTGTCTTTAAT
GCCAGTACCGGAGCTGTGCGGGAGCATGTGGTGGGCGGCGCCAAAGTCTCCGCCACGGCAGAGTTTGATGCGAGC
TTGGGCAAAAAGACGGTGCTTCCAATCGGCAGCAATGGCCTGCCGACTCGTGCGCTGCCTCTAGGATGGAAGAGC
GAGCAGACAATTGTTATAGTCGAAGATGGAGTCGTACGGGGTGTAAAGTACCGCCACGACGAGGGCAAGACGACT
AGACACGACATGTGGCAGCTGCAGCTCTTTGCGCGCCAACGCATCCTCCAAATCGCCACACCACCCCGTCACGAC
CCCATTGCCTCGGTTGGCCGCGTCCTCGGCGACCGGCGCGTCATGTACAAGTACCTCGATGCAAACGCCCTCGTC
GTGGCCGCCATTGACGACGCCACCCACCTCGTTTCCATTCGCCTCGTTGACGGCGTCTCGGGCCAAGTCCTTGCC
GCGCACGAGTATCCCGGCGTCGACGCCTCGCAGCCCGTGTCGTGCACCATGGCGGAAAACTGGTATGCCTGCGCC
TTCTTCGCCACATACCCCGTCGGCGCCCGCTCCATCCAGGGCCACCACCTCGTCGTGGCAGACCTTTACGAATCC
CCCCTGCCAAACGACCGCGGGCCCTGGGGCGACGACGCCGCCACCAACTCGTCGGCCCTGCTGCCTCTAGACTCG
CCGCTTGCTGCCGCGCCGCCCCTGCCGCACGTTGTTGCCCAAGCCTTTGTCGTGTCGGAGCCCCTCGCCGCGCTG
TGCGTCTCCCAGACGCGCCAGGGCATCACCACGCGCCAGCTAAACGCCTACCTGCCCGCCTCGCACGCCCTCGTT
GGCCTGCCCCGGCCCATTATCGATCCGCGGCGTCCAGTCGGCCGCGACCCCTCGGCGGCAGATGTCGAGGCTGAG
GGTCTCATGCGCTACACGCCCGCTCTGGAAATCGACCCGCGGTCCGTCTTTTCCCATCAGCGCGACGTGCTGCGC
ATACGTGCTCTTGTGCCGGCGCCCACGCTTGTTGAGAGTACCTCGTTGCTCGCCGCCATTGGCACAGACGTCTAC
GTTGCGCGCCTCGCGCCAAGTGGCGTGTTTGACATTCTCGGAAAGGGTTTCAATAAAACCTCCCTCTTGGCAACC
GTTCTTGCCCTCTTGGCAGGAGTCTTGTTTCTACGGCCACTGGTCCGAAGAAAACAAATCGACCGTCGATGGGAG
GCCTTTCTCTAA
Gene >OphauB2|6463
ATGCGACAATCACTGCATTCGGCCCTGCTGCTGGGCCTGTGCGCCTTTGGTGGTGCCATATTCCAGGATGAAGTG
GGAGACGTGGACTTTCATTACGCTTTGCTTGGCCACCCGCAGCCCGAAACGACATTTTTCCACCGCCCCAGACGA
GACGATCGAGCCAGCTTGTTATACACGCTCAGCGACATTGGCATTCTTGGCGCGGTGAATCCAAGCAACGGGGAC
CTGATATGGCGGCATGAGGTTGTCAAGAATGCGACAAGTGGCGACAAGAGCTTTTTGCGGGCGCCTGATGGCGAC
GATTGGGTGGTGGCTGCCCACGGCTCTGCAGTGTCGGCGTGGAATGCGCTGACGGGGCGCAACGTGTGGCACATG
GAGTTTAGCGAAAGGATACGAGACGTTGAGATTTTGCAAATGACGGAAACGTCACACAGGGATGTCTTGGTGCTG
TTTGATGACGAGGGCGTGACCGTCTTGAGAAGGCTGCACGGTACTCTTGGCTCCGTTGTTTGGGAATTCCGCGAT
ACAAGAGGTCATTCGCCGCTTCAAGTGTCCAACGACGTGACGCATGTCTTTGCCATTGGACTGGAGGGAGCGGCG
CCTTCCTATAGTCTCCGAATTGTGTCGCTGGACGTGGCAACGGGCAGCCTTGTCGACGTCTGGTCTGTGGGTTCC
AAGGACGAGATTCAGACGCCTCAAGATGTAATGTTTGTTGGTGCCAACTCTGCAGCTCCCATTGTGGCGTGGACG
GACCCTGGACTATCCAAGCTGAGCATCAATGCGCTGGGCAGCCGGTCAAAGCAAGACTTTCACCTCCCACCAGAC
ACCATGGCGGTCAATATTCACGCGCCGCACCTCGCGCAGTCACAAACTCACTTCTTGGTGCACATCAAGACGCAG
CCTGAATCGCTGGGCGGCGAGGAGGAGAACAAGGCCTTGGTGTTTCACACGGACATCAAGACGGGGCAAATCAAG
CTTGCTTACGAACTGCCTCACTTTCGCGGCAAGGGCACCTTTGCGACGAGCTCTGATGGGGCAAATGTCTACTTT
GTGCAGATTGGCGAGGAGGAGACGCTAGTCGTATCGTCGGATTCACATGGCATTCTGGCCCGCTGGCCGAATCCC
AAGGCTGCCCCCATTGCCCCGATATGTGCCGTTGCAGAGGTGGTCAAGAAGCCGACTGGACAAGACGTTGCTCTG
CGCCAGGCAGTCTTTACCGCCAATGAAGACTGGGTCTTGGTACGAAATGGCGAGCGCTACTGGACGCGACACGAG
GGCCTGTCCGACTCTGTGGCGGCAGTGTGGGCCGAGATTCCAAGAGGACAAGACTTGGCCAAGGTGCTGGCTGAA
GAAGCACACACGAGCCCCCTTGCGGCGTATACGCATCGCGTGAAGCGCCATATCCACGACTTGCAGTACCTCCCC
GCATGGCTTGCTGATATCCCGTCGCGAGTGATTGAGAGCATGGTGGGCGATGGCGGCGGCGACAAGAAGACGACG
GGTCTTTATCGAGACAGTTTTGGATTCAACAAGATTCTCGTGGTTGGCACGCGTCGCGGGCGCTTTTACGGGCTG
GATGCCGCCAATGGGGGACGAGTGCTGTGGACGCAGAGCTGGTTTCCTCGCGAGACGCAGCATCCGCTCGTCATC
AAGGGCCTCTCTGCCGTGGACGAGGAAGGAAGTGTCGTCATGTACGGCGCCGACGGCGAGTATGTTGTCTTTAAT
GCCAGTACCGGAGCTGTGCGGGAGCATGTGGTGGGCGGCGCCAAAGTCTCCGCCACGGCAGAGTTTGATGCGAGC
TTGGGCAAAAAGACGGTGCTTCCAATCGGCAGCAATGGCCTGCCGACTCGTGCGCTGCCTCTAGGATGGAAGAGC
GAGCAGACAATTGTTATAGTCGAAGATGGAGTCGTACGGGGTGTAAAGTACCGCCACGACGAGGGCAAGACGACT
AGACACGACATGTGGCAGCTGCAGCTCTTTGCGCGCCAACGCATCCTCCAAATCGCCACACCACCCCGTCACGAC
CCCATTGCCTCGGTTGGCCGCGTCCTCGGCGACCGGCGCGTCATGTACAAGTACCTCGATGCAAACGCCCTCGTC
GTGGCCGCCATTGACGACGCCACCCACCTCGTTTCCATTCGCCTCGTTGACGGCGTCTCGGGCCAAGTCCTTGCC
GCGCACGAGTATCCCGGCGTCGACGCCTCGCAGCCCGTGTCGTGCACCATGGCGGAAAACTGGTATGCCTGCGCC
TTCTTCGCCACATACCCCGTCGGCGCCCGCTCCATCCAGGGCCACCACCTCGTCGTGGCAGACCTTTACGAATCC
CCCCTGCCAAACGACCGCGGGCCCTGGGGCGACGACGCCGCCACCAACTCGTCGGCCCTGCTGCCTCTAGACTCG
CCGCTTGCTGCCGCGCCGCCCCTGCCGCACGTTGTTGCCCAAGCCTTTGTCGTGTCGGAGCCCCTCGCCGCGCTG
TGCGTCTCCCAGACGCGCCAGGGCATCACCACGCGCCAGCTAAACGCCTACCTGCCCGCCTCGCACGCCCTCGTT
GGCCTGCCCCGGCCCATTATCGATCCGCGGCGTCCAGTCGGCCGCGACCCCTCGGCGGCAGATGTCGAGGCTGAG
GGTCTCATGCGCTACACGCCCGCTCTGGAAATCGACCCGCGGTCCGTCTTTTCCCATCAGCGCGACGTGCTGCGC
ATACGTGCTCTTGTGCCGGCGCCCACGCTTGTTGAGAGTACCTCGTTGCTCGCCGCCATTGGCACAGACGTCTAC
GTTGCGCGCCTCGCGCCAAGTGGCGTGTTTGACATTCTCGGAAAGGGTTTCAATAAAACCTCCCTCTTGGCAACC
GTTCTTGCCCTCTTGGCAGGAGTCTTGTTTCTACGGCCACTGGTGAGTTTTCTTTCTTTCTTCTTTTGGAGCCCT
CCTCTTTTCCGAATTTGCTTGCTCACGCCTGTCTCCAGGTCCGAAGAAAACAAATCGACCGTCGATGGGAGGCCT
TTCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail