Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6460
Gene name
LocationContig_6:65666..67712
Strand+
Gene length (bp)2046
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01425 Amidase Amidase 9.2E-36 171 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FR37|AMI1_ARATH Amidase 1 OS=Arabidopsis thaliana GN=AMI1 PE=1 SV=1 193 557 8.0E-24
sp|B7PDC5|GATA_IXOSC Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ixodes scapularis GN=gatA PE=3 SV=1 184 346 3.0E-19
sp|C1D1L2|GATA_DEIDV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=gatA PE=3 SV=1 150 375 7.0E-19
sp|Q9RTA9|GATA_DEIRA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gatA PE=3 SV=1 147 379 9.0E-19
sp|Q2GEE7|GATA_NEOSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neorickettsia sennetsu (strain Miyayama) GN=gatA PE=3 SV=1 193 450 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FR37|AMI1_ARATH Amidase 1 OS=Arabidopsis thaliana GN=AMI1 PE=1 SV=1 193 557 8.0E-24
sp|B7PDC5|GATA_IXOSC Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ixodes scapularis GN=gatA PE=3 SV=1 184 346 3.0E-19
sp|C1D1L2|GATA_DEIDV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=gatA PE=3 SV=1 150 375 7.0E-19
sp|Q9RTA9|GATA_DEIRA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gatA PE=3 SV=1 147 379 9.0E-19
sp|Q2GEE7|GATA_NEOSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neorickettsia sennetsu (strain Miyayama) GN=gatA PE=3 SV=1 193 450 1.0E-18
sp|A5GTM0|GATA_SYNR3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain RCC307) GN=gatA PE=3 SV=1 192 459 2.0E-18
sp|Q1J0C2|GATA_DEIGD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus geothermalis (strain DSM 11300) GN=gatA PE=3 SV=1 192 372 2.0E-18
sp|C4ZHB9|GATA_EUBR3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=gatA PE=3 SV=1 193 347 5.0E-18
sp|Q3Z6V3|GATA_DEHM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gatA PE=3 SV=1 191 347 2.0E-17
sp|Q5PAL2|GATA_ANAMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaplasma marginale (strain St. Maries) GN=gatA PE=3 SV=1 174 385 6.0E-17
sp|B9KIR2|GATA_ANAMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaplasma marginale (strain Florida) GN=gatA PE=3 SV=1 174 385 6.0E-17
sp|B5ED19|GATA_GEOBB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gatA PE=3 SV=1 192 347 1.0E-16
sp|C6E6Z2|GATA_GEOSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter sp. (strain M21) GN=gatA PE=3 SV=1 192 347 1.0E-16
sp|Q8THJ1|GATA_METAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gatA PE=3 SV=1 190 383 2.0E-16
sp|Q5V2G6|GATA_HALMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gatA PE=3 SV=1 192 558 2.0E-16
sp|E0VSP9|GATA_PEDHC Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Pediculus humanus subsp. corporis GN=gatA PE=3 SV=1 175 383 2.0E-16
sp|F4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana GN=OM64 PE=1 SV=1 190 348 2.0E-16
sp|Q7QH64|GATA_ANOGA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Anopheles gambiae GN=gatA PE=3 SV=3 186 346 3.0E-16
sp|Q0VS72|GATA_ALCBS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gatA PE=3 SV=1 193 447 3.0E-16
sp|Q6AQK1|GATA_DESPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=gatA PE=3 SV=1 192 346 4.0E-16
sp|A5FQ07|GATA_DEHMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=gatA PE=3 SV=1 191 347 4.0E-16
sp|Q3ZYM5|GATA_DEHMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain CBDB1) GN=gatA PE=3 SV=1 191 347 4.0E-16
sp|Q5HBG3|GATA_EHRRW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia ruminantium (strain Welgevonden) GN=gatA PE=3 SV=1 183 385 4.0E-16
sp|Q97EX8|GATA2_CLOAB Glutamyl-tRNA(Gln) amidotransferase subunit A 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatA2 PE=3 SV=1 193 346 5.0E-16
sp|Q5FHN7|GATA_EHRRG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia ruminantium (strain Gardel) GN=gatA PE=3 SV=2 193 385 8.0E-16
sp|A9KJ26|GATA_CLOPH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gatA PE=3 SV=1 187 346 9.0E-16
sp|Q9LVH5|OE64C_ARATH Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana GN=OEP64 PE=1 SV=1 195 368 1.0E-15
sp|Q5FND3|GATA_GLUOX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Gluconobacter oxydans (strain 621H) GN=gatA PE=3 SV=1 155 347 1.0E-15
sp|Q3A2K0|GATA_PELCD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gatA PE=3 SV=1 193 347 1.0E-15
sp|A7NKM0|GATA_ROSCS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=gatA PE=3 SV=1 192 373 1.0E-15
sp|Q46E35|GATA_METBF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gatA PE=3 SV=1 192 557 2.0E-15
sp|Q9Z9G7|GATA_CHLPN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia pneumoniae GN=gatA PE=3 SV=1 189 404 2.0E-15
sp|Q4J965|GATA_SULAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gatA PE=3 SV=1 193 374 2.0E-15
sp|Q971U6|GATA_SULTO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gatA PE=3 SV=2 187 347 3.0E-15
sp|F7A3P2|GATA_ORNAN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ornithorhynchus anatinus GN=QRSL1 PE=3 SV=1 173 387 3.0E-15
sp|Q2GGC5|GATA_EHRCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=gatA PE=3 SV=1 185 385 3.0E-15
sp|Q1IUE4|GATA_KORVE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Koribacter versatilis (strain Ellin345) GN=gatA PE=3 SV=1 193 358 4.0E-15
sp|A1KUH8|GATA_NEIMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gatA PE=3 SV=1 193 346 4.0E-15
sp|Q12VH1|GATA_METBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gatA PE=3 SV=1 192 345 4.0E-15
sp|Q2FQM9|GATA_METHJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=gatA PE=3 SV=1 192 447 4.0E-15
sp|B4RM85|GATA_NEIG2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gatA PE=3 SV=1 193 346 4.0E-15
sp|C1F857|GATA_ACIC5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=gatA PE=3 SV=1 192 372 5.0E-15
sp|A0LSR0|GATA_ACIC1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=gatA PE=3 SV=1 192 346 5.0E-15
sp|Q5NPF3|GATA_ZYMMO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gatA PE=3 SV=1 191 360 5.0E-15
sp|F1QAJ4|GATA_DANRE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Danio rerio GN=qrsl1 PE=2 SV=1 192 383 5.0E-15
sp|A4J6Z8|GATA_DESRM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfotomaculum reducens (strain MI-1) GN=gatA PE=3 SV=1 192 387 6.0E-15
sp|Q88XP7|GATA_LACPL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gatA PE=3 SV=1 193 387 6.0E-15
sp|Q8PXJ1|GATA_METMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gatA PE=3 SV=1 190 383 8.0E-15
sp|Q5F8U8|GATA_NEIG1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gatA PE=3 SV=1 193 346 9.0E-15
sp|B2IYD7|GATA_NOSP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gatA PE=3 SV=1 193 342 1.0E-14
sp|Q1MPY8|GATA_LAWIP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gatA PE=3 SV=1 189 466 1.0E-14
sp|A5UXF9|GATA_ROSS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseiflexus sp. (strain RS-1) GN=gatA PE=3 SV=1 192 372 1.0E-14
sp|Q746Y7|GATA_GEOSL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gatA PE=3 SV=1 192 347 2.0E-14
sp|Q8AVG9|GATA_XENLA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Xenopus laevis GN=qrsl1 PE=2 SV=1 189 383 2.0E-14
sp|B8I601|GATA_CLOCE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=gatA PE=3 SV=1 193 459 2.0E-14
sp|Q3AVK4|GATA_SYNS9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9902) GN=gatA PE=3 SV=1 192 342 2.0E-14
sp|Q3ISR6|GATA_NATPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gatA PE=3 SV=1 188 558 2.0E-14
sp|B1WYP3|GATA_CYAA5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain ATCC 51142) GN=gatA PE=3 SV=1 193 347 2.0E-14
sp|Q9JTZ5|GATA_NEIMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gatA PE=3 SV=1 193 346 3.0E-14
sp|Q73Q68|GATA_TREDE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gatA PE=3 SV=1 190 347 3.0E-14
sp|Q9JYZ9|GATA_NEIMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup B (strain MC58) GN=gatA PE=3 SV=1 193 346 3.0E-14
sp|P73558|GATA_SYNY3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gatA PE=3 SV=1 193 372 3.0E-14
sp|Q0AZZ2|GATA_SYNWW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gatA PE=3 SV=1 193 373 3.0E-14
sp|A9M003|GATA_NEIM0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup C (strain 053442) GN=gatA PE=3 SV=1 193 346 3.0E-14
sp|Q39ZK0|GATA_GEOMG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gatA PE=3 SV=1 192 372 3.0E-14
sp|Q3YSB0|GATA_EHRCJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia canis (strain Jake) GN=gatA PE=3 SV=2 192 385 4.0E-14
sp|Q97ZG1|GATA_SULSO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gatA-2 PE=3 SV=1 193 347 4.0E-14
sp|Q9ZE10|GATA_RICPR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia prowazekii (strain Madrid E) GN=gatA PE=3 SV=1 185 346 4.0E-14
sp|E2QUD0|GATA_CANLF Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Canis lupus familiaris GN=QRSL1 PE=3 SV=1 193 383 4.0E-14
sp|B0JSX3|GATA_MICAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Microcystis aeruginosa (strain NIES-843) GN=gatA PE=3 SV=1 193 346 4.0E-14
sp|Q936X3|ATZE_PSESD Biuret hydrolase OS=Pseudomonas sp. (strain ADP) GN=atzE PE=1 SV=1 192 345 5.0E-14
sp|Q820J1|GATA_NITEU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gatA PE=3 SV=1 192 346 5.0E-14
sp|Q9H0R6|GATA_HUMAN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Homo sapiens GN=QRSL1 PE=1 SV=2 193 346 5.0E-14
sp|Q68XL6|GATA_RICTY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gatA PE=3 SV=1 185 346 5.0E-14
sp|A5EY31|GATA_DICNV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dichelobacter nodosus (strain VCS1703A) GN=gatA PE=3 SV=1 192 407 5.0E-14
sp|Q9MUK5|TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum GN=TOC64 PE=1 SV=1 194 358 6.0E-14
sp|Q3AD36|GATA_CARHZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gatA PE=3 SV=1 172 383 6.0E-14
sp|A6W7L7|GATA_KINRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=gatA PE=3 SV=1 192 346 6.0E-14
sp|B2A5W7|GATA_NATTJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=gatA PE=3 SV=1 192 557 7.0E-14
sp|Q4R7R9|GATA_MACFA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Macaca fascicularis GN=QRSL1 PE=2 SV=1 193 346 8.0E-14
sp|Q113L8|GATA_TRIEI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Trichodesmium erythraeum (strain IMS101) GN=gatA PE=3 SV=1 193 346 8.0E-14
sp|B0WAE3|GATA_CULQU Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Culex quinquefasciatus GN=gatA PE=3 SV=1 192 346 8.0E-14
sp|Q60CK8|GATA_METCA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gatA PE=3 SV=1 156 346 8.0E-14
sp|B0C269|GATA_ACAM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acaryochloris marina (strain MBIC 11017) GN=gatA PE=3 SV=1 193 346 8.0E-14
sp|Q2GJX4|GATA_ANAPZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaplasma phagocytophilum (strain HZ) GN=gatA PE=3 SV=1 192 385 9.0E-14
sp|B4UIV1|GATA_ANASK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter sp. (strain K) GN=gatA PE=3 SV=1 190 374 9.0E-14
sp|B3CMT8|GATA_WOLPP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=gatA PE=3 SV=1 192 346 1.0E-13
sp|Q2RGY4|GATA_MOOTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Moorella thermoacetica (strain ATCC 39073) GN=gatA PE=3 SV=1 192 372 1.0E-13
sp|Q2RPH4|GATA_RHORT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gatA PE=3 SV=1 192 361 1.0E-13
sp|Q5GRM3|GATA_WOLTR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=gatA PE=3 SV=2 192 346 1.0E-13
sp|B1I3K2|GATA_DESAP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulforudis audaxviator (strain MP104C) GN=gatA PE=3 SV=1 192 375 1.0E-13
sp|Q2J6U6|GATA_FRASC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Frankia sp. (strain CcI3) GN=gatA PE=3 SV=1 192 346 1.0E-13
sp|A1U486|GATA_MARHV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gatA PE=3 SV=1 195 388 1.0E-13
sp|Q0BZV5|GATA_HYPNA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Hyphomonas neptunium (strain ATCC 15444) GN=gatA PE=3 SV=1 122 346 1.0E-13
sp|Q73HP2|GATA_WOLPM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia pipientis wMel GN=gatA PE=3 SV=1 192 346 2.0E-13
sp|C0R5M6|GATA_WOLWR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=gatA PE=3 SV=1 192 346 2.0E-13
sp|Q5LP80|GATA_RUEPO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gatA PE=3 SV=1 193 362 2.0E-13
sp|Q4UKF1|GATA_RICFE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gatA PE=3 SV=1 185 346 2.0E-13
sp|Q31LC2|GATA_SYNE7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus elongatus (strain PCC 7942) GN=gatA PE=3 SV=1 193 346 2.0E-13
sp|Q5L6I9|GATA_CHLAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=gatA PE=3 SV=1 189 342 2.0E-13
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 190 383 2.0E-13
sp|Q2IH94|GATA_ANADE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gatA PE=3 SV=1 190 374 2.0E-13
sp|Q5N0K5|GATA_SYNP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gatA PE=3 SV=1 193 346 2.0E-13
sp|C4Z3J4|GATA_EUBE2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=gatA PE=3 SV=1 192 347 2.0E-13
sp|Q9LI77|GATA_ARATH Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GATA PE=2 SV=1 192 345 2.0E-13
sp|Q2YC91|GATA_NITMU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gatA PE=3 SV=2 174 346 2.0E-13
sp|C4L690|GATA_EXISA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=gatA PE=3 SV=1 186 346 2.0E-13
sp|Q8YY02|GATA_NOSS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gatA PE=3 SV=1 193 342 3.0E-13
sp|A5GKM7|GATA_SYNPW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain WH7803) GN=gatA PE=3 SV=1 192 342 3.0E-13
sp|Q3M6N4|GATA_ANAVT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gatA PE=3 SV=1 193 342 3.0E-13
sp|B7KLL5|GATA_CYAP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 7424) GN=gatA PE=3 SV=1 193 346 3.0E-13
sp|A8ZSP8|GATA_DESOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=gatA PE=3 SV=1 192 347 3.0E-13
sp|B8JBQ1|GATA_ANAD2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=gatA PE=3 SV=1 190 374 3.0E-13
sp|B7K0I2|GATA_CYAP8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 8801) GN=gatA PE=3 SV=1 193 346 3.0E-13
sp|Q8UFS8|GATA_AGRFC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gatA PE=3 SV=2 154 349 3.0E-13
sp|Q9LCX3|GATA_THET8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gatA PE=1 SV=2 189 349 3.0E-13
sp|Q72L58|GATA_THET2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gatA PE=3 SV=1 189 349 3.0E-13
sp|Q0ACB5|GATA_ALKEH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gatA PE=3 SV=1 192 346 3.0E-13
sp|Q54L63|GATA_DICDI Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Dictyostelium discoideum GN=gatA PE=3 SV=1 185 347 4.0E-13
sp|C3PMJ0|GATA_RICAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia africae (strain ESF-5) GN=gatA PE=3 SV=1 185 346 4.0E-13
sp|C4K0R4|GATA_RICPU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia peacockii (strain Rustic) GN=gatA PE=3 SV=1 185 346 4.0E-13
sp|A8GQX7|GATA_RICRS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia rickettsii (strain Sheila Smith) GN=gatA PE=3 SV=1 185 346 4.0E-13
sp|B0BWC3|GATA_RICRO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia rickettsii (strain Iowa) GN=gatA PE=3 SV=1 185 346 4.0E-13
sp|Q92J75|GATA_RICCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gatA PE=3 SV=1 185 346 4.0E-13
sp|Q2LXM9|GATA_SYNAS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophus aciditrophicus (strain SB) GN=gatA PE=3 SV=1 193 383 4.0E-13
sp|Q9CZN8|GATA_MOUSE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Mus musculus GN=Qrsl1 PE=1 SV=1 193 383 4.0E-13
sp|A8M5E6|GATA_SALAI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinispora arenicola (strain CNS-205) GN=gatA PE=3 SV=1 131 346 5.0E-13
sp|B1YM01|GATA_EXIS2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=gatA PE=3 SV=1 186 346 5.0E-13
sp|A8GV46|GATA_RICB8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia bellii (strain OSU 85-389) GN=gatA PE=3 SV=1 185 346 5.0E-13
sp|Q1RHE9|GATA_RICBR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia bellii (strain RML369-C) GN=gatA PE=3 SV=1 185 346 6.0E-13
sp|Q936X2|ATZF_PSESD Allophanate hydrolase OS=Pseudomonas sp. (strain ADP) GN=atzF PE=1 SV=1 158 362 6.0E-13
sp|A5WCI2|GATA_PSYWF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter sp. (strain PRwf-1) GN=gatA PE=3 SV=1 193 368 6.0E-13
sp|A8GMC0|GATA_RICAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia akari (strain Hartford) GN=gatA PE=3 SV=1 185 346 6.0E-13
sp|Q6MRL7|GATA_BDEBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gatA PE=3 SV=1 193 342 7.0E-13
sp|C5BSY8|GATA_TERTT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gatA PE=3 SV=1 193 383 7.0E-13
sp|Q29BT3|GATA_DROPS Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=gatA PE=3 SV=2 184 346 7.0E-13
sp|Q8DK65|GATA_THEEB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermosynechococcus elongatus (strain BP-1) GN=gatA PE=3 SV=2 193 372 7.0E-13
sp|Q0VFI5|GATA_XENTR Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Xenopus tropicalis GN=qrsl1 PE=2 SV=1 189 383 8.0E-13
sp|B4U197|GATA_STREM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=gatA PE=3 SV=1 189 342 8.0E-13
sp|A2CA16|GATA_PROM3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9303) GN=gatA PE=3 SV=1 192 342 8.0E-13
sp|Q6A8P5|GATA_PROAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=gatA PE=3 SV=1 192 346 8.0E-13
sp|Q168I9|GATA_ROSDO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gatA PE=3 SV=1 193 362 9.0E-13
sp|Q7V7T6|GATA_PROMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9313) GN=gatA PE=3 SV=1 192 342 9.0E-13
sp|A0LP22|GATA_SYNFM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=gatA PE=3 SV=1 192 372 1.0E-12
sp|A5G9J9|GATA_GEOUR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter uraniireducens (strain Rf4) GN=gatA PE=3 SV=1 157 347 1.0E-12
sp|P95896|AMID_SULSO Amidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2122 PE=1 SV=1 193 345 1.0E-12
sp|Q0SNH0|GATA_BORAP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Borrelia afzelii (strain PKo) GN=gatA PE=3 SV=1 192 345 1.0E-12
sp|Q2G4F5|GATA_NOVAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gatA PE=3 SV=1 189 347 1.0E-12
sp|Q29RP9|GATA_BOVIN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Bos taurus GN=QRSL1 PE=2 SV=1 193 383 1.0E-12
sp|P75534|GATA_MYCPN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=gatA PE=3 SV=1 190 346 1.0E-12
sp|B0TDK7|GATA_HELMI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=gatA PE=3 SV=1 192 383 1.0E-12
sp|C0M7E8|GATA_STRE4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. equi (strain 4047) GN=gatA PE=3 SV=1 189 342 1.0E-12
sp|Q7U7F4|GATA_SYNPX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain WH8102) GN=gatA PE=3 SV=1 192 342 1.0E-12
sp|Q17H91|GATA_AEDAE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Aedes aegypti GN=gatA PE=3 SV=1 171 383 1.0E-12
sp|Q2SBG5|GATA_HAHCH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Hahella chejuensis (strain KCTC 2396) GN=gatA PE=3 SV=1 193 383 1.0E-12
sp|C0ME97|GATA_STRS7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=gatA PE=3 SV=1 189 342 1.0E-12
sp|B0VS13|GATA_ACIBS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain SDF) GN=gatA PE=3 SV=1 193 412 2.0E-12
sp|C6BSE9|GATA_DESAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=gatA PE=3 SV=1 191 383 2.0E-12
sp|O27955|GATA_ARCFU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gatA PE=3 SV=1 193 345 2.0E-12
sp|Q0I9N6|GATA_SYNS3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9311) GN=gatA PE=3 SV=1 192 342 2.0E-12
sp|B1XJG8|GATA_SYNP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gatA PE=3 SV=1 193 346 2.0E-12
sp|Q0AFP4|GATA_NITEC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosomonas eutropha (strain C91) GN=gatA PE=3 SV=1 193 346 2.0E-12
sp|O51317|GATA_BORBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gatA PE=3 SV=2 192 345 2.0E-12
sp|Q07L94|GATA_RHOP5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain BisA53) GN=gatA PE=3 SV=1 169 361 2.0E-12
sp|B8HY89|GATA_CYAP4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=gatA PE=3 SV=1 193 342 2.0E-12
sp|B0VEN3|GATA_ACIBY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AYE) GN=gatA PE=3 SV=1 193 412 2.0E-12
sp|B2HY00|GATA_ACIBC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain ACICU) GN=gatA PE=3 SV=1 193 412 2.0E-12
sp|B7GXC5|GATA_ACIB3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AB307-0294) GN=gatA PE=3 SV=1 193 412 2.0E-12
sp|Q4FLQ7|GATA_PELUB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelagibacter ubique (strain HTCC1062) GN=gatA PE=3 SV=1 193 374 2.0E-12
sp|A3M8F1|GATA_ACIBT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=gatA PE=3 SV=2 193 412 3.0E-12
sp|B7I7N2|GATA_ACIB5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AB0057) GN=gatA PE=3 SV=1 193 412 3.0E-12
sp|Q1DCA3|GATA_MYXXD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Myxococcus xanthus (strain DK 1622) GN=gatA PE=3 SV=1 186 346 3.0E-12
sp|Q9VE09|GATA_DROME Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Drosophila melanogaster GN=gatA PE=2 SV=1 184 346 3.0E-12
sp|Q21FS8|GATA_SACD2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gatA PE=3 SV=1 193 346 3.0E-12
sp|P27765|AMID_PSECL Amidase OS=Pseudomonas chlororaphis PE=1 SV=3 193 342 3.0E-12
sp|A8LJ23|GATA_DINSH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gatA PE=3 SV=1 193 387 3.0E-12
sp|A0L5G0|GATA_MAGMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gatA PE=3 SV=1 192 346 3.0E-12
sp|A8EXM1|GATA_RICCK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia canadensis (strain McKiel) GN=gatA PE=3 SV=1 185 346 4.0E-12
sp|Q2K939|GATA_RHIEC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gatA PE=3 SV=1 151 400 4.0E-12
sp|Q28T24|GATA_JANSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Jannaschia sp. (strain CCS1) GN=gatA PE=3 SV=1 176 387 4.0E-12
sp|B8J405|GATA_DESDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=gatA PE=3 SV=1 191 346 4.0E-12
sp|B1GZD3|GATA_UNCTG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gatA PE=3 SV=1 193 346 4.0E-12
sp|B9LER8|GATA_CHLSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=gatA PE=3 SV=1 192 345 4.0E-12
sp|A9WCD8|GATA_CHLAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=gatA PE=3 SV=1 192 345 4.0E-12
sp|Q9HR43|GATA_HALSA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gatA PE=3 SV=1 192 558 4.0E-12
sp|A4X490|GATA_SALTO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=gatA PE=3 SV=1 189 346 4.0E-12
sp|B0T193|GATA_CAUSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter sp. (strain K31) GN=gatA PE=3 SV=1 148 346 5.0E-12
sp|Q3SR31|GATA_NITWN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gatA PE=3 SV=1 186 361 5.0E-12
sp|Q6FDY3|GATA_ACIAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gatA PE=3 SV=1 193 361 5.0E-12
sp|C0RLB5|GATA_BRUMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gatA PE=3 SV=1 173 349 5.0E-12
sp|Q8YC57|GATA_BRUME Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gatA PE=3 SV=2 173 349 5.0E-12
sp|A6X562|GATA_OCHA4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gatA PE=3 SV=1 173 349 6.0E-12
sp|A5EKP4|GATA_BRASB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gatA PE=3 SV=1 169 372 6.0E-12
sp|A5VUS6|GATA_BRUO2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gatA PE=3 SV=1 173 349 6.0E-12
sp|A9WYR3|GATA_BRUSI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gatA PE=3 SV=1 173 349 6.0E-12
sp|O28325|Y1954_ARCFU Putative amidase AF_1954 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1954 PE=3 SV=1 192 346 6.0E-12
sp|A9MBN4|GATA_BRUC2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gatA PE=3 SV=1 173 349 6.0E-12
sp|Q1QL30|GATA_NITHX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gatA PE=3 SV=1 169 349 6.0E-12
sp|Q25A68|GATA_ORYSI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Oryza sativa subsp. indica GN=GATA PE=3 SV=1 192 345 6.0E-12
sp|Q8FW67|GATA_BRUSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella suis biovar 1 (strain 1330) GN=gatA PE=3 SV=1 173 349 6.0E-12
sp|Q661S5|GATA_BORBP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=gatA PE=3 SV=1 192 345 7.0E-12
sp|A8AVE2|GATA_STRGC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gatA PE=3 SV=1 193 342 7.0E-12
sp|C5Y8Z8|GATA_SORBI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Sorghum bicolor GN=GATA PE=3 SV=1 192 345 7.0E-12
sp|E0CTY1|GATA_VITVI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Vitis vinifera GN=GATA PE=3 SV=1 192 345 7.0E-12
sp|Q3AKH0|GATA_SYNSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9605) GN=gatA PE=3 SV=1 192 342 7.0E-12
sp|B8EPC1|GATA_METSB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gatA PE=3 SV=1 169 372 7.0E-12
sp|B8G974|GATA_CHLAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=gatA PE=3 SV=1 192 345 8.0E-12
sp|Q7X8Z8|GATA_ORYSJ Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=GATA PE=3 SV=3 192 345 8.0E-12
sp|B3PC08|GATA_CELJU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cellvibrio japonicus (strain Ueda107) GN=gatA PE=3 SV=1 193 346 8.0E-12
sp|Q48E92|GATA_PSE14 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gatA PE=3 SV=1 192 346 8.0E-12
sp|B6JFW2|GATA_OLICO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gatA PE=3 SV=1 169 361 8.0E-12
sp|A9B9W7|GATA_PROM4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9211) GN=gatA PE=3 SV=1 192 342 8.0E-12
sp|B5ZMJ0|GATA_RHILW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gatA PE=3 SV=1 193 349 9.0E-12
sp|Q1MHJ5|GATA_RHIL3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gatA PE=3 SV=1 193 349 9.0E-12
sp|Q2JUM6|GATA_SYNJA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain JA-3-3Ab) GN=gatA PE=3 SV=1 192 346 9.0E-12
sp|Q2JL51|GATA_SYNJB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gatA PE=3 SV=1 192 346 1.0E-11
sp|Q9Z580|GATA_STRCO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gatA PE=3 SV=1 192 346 1.0E-11
sp|Q04BV7|GATA_LACDB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=gatA PE=3 SV=1 190 346 1.0E-11
sp|Q5FWT5|GATA_RAT Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Rattus norvegicus GN=Qrsl1 PE=2 SV=1 193 383 1.0E-11
sp|Q1QDJ4|GATA_PSYCK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter cryohalolentis (strain K5) GN=gatA PE=3 SV=1 190 346 1.0E-11
sp|Q1GBF4|GATA_LACDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=gatA PE=3 SV=1 190 346 1.0E-11
sp|B9LZ18|GATA_GEODF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=gatA PE=3 SV=1 193 347 1.0E-11
sp|Q82JL0|GATA_STRAW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gatA PE=3 SV=1 192 346 1.0E-11
sp|A0Q2Q0|GATA_CLONN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium novyi (strain NT) GN=gatA PE=3 SV=1 191 347 1.0E-11
sp|Q9YB80|GATA_AERPE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gatA PE=3 SV=2 193 346 1.0E-11
sp|Q2IXB7|GATA_RHOP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain HaA2) GN=gatA PE=3 SV=1 135 349 1.0E-11
sp|O69768|AMID_PSEPU Amidase OS=Pseudomonas putida PE=3 SV=1 192 346 1.0E-11
sp|Q4FUG4|GATA_PSYA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gatA PE=3 SV=1 190 346 1.0E-11
sp|Q11IL4|GATA_CHESB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chelativorans sp. (strain BNC1) GN=gatA PE=3 SV=1 191 349 1.0E-11
sp|A5V3V0|GATA_SPHWW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gatA PE=3 SV=1 192 349 1.0E-11
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 192 345 1.0E-11
sp|Q253Q1|GATA_CHLFF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydophila felis (strain Fe/C-56) GN=gatA PE=3 SV=1 189 342 1.0E-11
sp|B6U151|GATA_MAIZE Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Zea mays GN=GATA PE=2 SV=1 192 345 2.0E-11
sp|O66610|GATA_AQUAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aquifex aeolicus (strain VF5) GN=gatA PE=1 SV=1 187 346 2.0E-11
sp|Q84DC4|MANHY_PSEPU Mandelamide hydrolase OS=Pseudomonas putida GN=mdlY PE=1 SV=1 192 346 2.0E-11
sp|Q03AC0|GATA_LACC3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus casei (strain ATCC 334) GN=gatA PE=3 SV=1 191 379 2.0E-11
sp|Q5WVW0|GATA_LEGPL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Lens) GN=gatA PE=3 SV=1 173 346 2.0E-11
sp|Q5X4H5|GATA_LEGPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Paris) GN=gatA PE=3 SV=1 173 346 2.0E-11
sp|A8N8S3|GATA_COPC7 Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_00798 PE=3 SV=1 192 347 2.0E-11
sp|Q87WR9|GATA_PSESM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gatA PE=3 SV=1 192 346 2.0E-11
sp|B8D125|GATA_HALOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gatA PE=3 SV=1 193 347 2.0E-11
sp|A5ICP2|GATA_LEGPC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Corby) GN=gatA PE=3 SV=1 173 346 2.0E-11
sp|A1ATL3|GATA_PELPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelobacter propionicus (strain DSM 2379) GN=gatA PE=3 SV=1 193 347 2.0E-11
sp|Q135J7|GATA_RHOPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain BisB5) GN=gatA PE=3 SV=1 192 361 2.0E-11
sp|B3Q9W5|GATA_RHOPT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain TIE-1) GN=gatA PE=3 SV=1 169 361 3.0E-11
sp|Q6N575|GATA_RHOPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gatA PE=3 SV=1 169 361 3.0E-11
sp|Q5NIP6|GATA_FRATT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gatA PE=3 SV=1 190 344 3.0E-11
sp|Q14K49|GATA_FRAT1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gatA PE=3 SV=1 190 344 3.0E-11
sp|A8I9X6|GATA_AZOC5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gatA PE=3 SV=1 173 346 3.0E-11
sp|Q1GUW3|GATA_SPHAL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gatA PE=3 SV=1 191 383 3.0E-11
sp|Q83BM9|GATA_COXBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gatA PE=3 SV=1 176 383 3.0E-11
sp|A9N8Z4|GATA_COXBR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gatA PE=3 SV=1 176 383 3.0E-11
sp|A9KBI0|GATA_COXBN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gatA PE=3 SV=1 176 383 3.0E-11
sp|B6IZ25|GATA_COXB2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain CbuG_Q212) GN=gatA PE=3 SV=1 176 383 3.0E-11
sp|B6J4H5|GATA_COXB1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain CbuK_Q154) GN=gatA PE=3 SV=1 176 383 3.0E-11
sp|Q46L72|GATA_PROMT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain NATL2A) GN=gatA PE=3 SV=1 192 347 3.0E-11
sp|A0Q8I2|GATA_FRATN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. novicida (strain U112) GN=gatA PE=3 SV=1 190 345 3.0E-11
sp|C3MAA3|GATA_RHISN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium sp. (strain NGR234) GN=gatA PE=3 SV=1 171 349 3.0E-11
sp|Q97FQ7|GATA1_CLOAB Glutamyl-tRNA(Gln) amidotransferase subunit A 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatA1 PE=3 SV=1 193 347 3.0E-11
sp|A2C1Y1|GATA_PROM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain NATL1A) GN=gatA PE=3 SV=1 192 347 3.0E-11
sp|B3WD57|GATA_LACCB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus casei (strain BL23) GN=gatA PE=3 SV=1 191 379 4.0E-11
sp|Q5ZUQ7|GATA_LEGPH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gatA PE=3 SV=1 173 346 4.0E-11
sp|B3CQQ9|GATA_ORITI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Orientia tsutsugamushi (strain Ikeda) GN=gatA PE=3 SV=1 170 346 4.0E-11
sp|Q9A5L0|GATA_CAUCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gatA PE=3 SV=1 169 346 4.0E-11
sp|B8GZJ5|GATA_CAUCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gatA PE=3 SV=1 169 346 4.0E-11
sp|A3CLF8|GATA_STRSV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus sanguinis (strain SK36) GN=gatA PE=3 SV=1 193 342 4.0E-11
sp|A6VH97|GATA_METM7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=gatA PE=3 SV=1 190 347 5.0E-11
sp|Q0BK40|GATA_FRATO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gatA PE=3 SV=1 190 344 5.0E-11
sp|Q2A1D8|GATA_FRATH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gatA PE=3 SV=1 190 344 5.0E-11
sp|A7NEM1|GATA_FRATF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gatA PE=3 SV=1 190 344 5.0E-11
sp|B5YL59|GATA_THEYD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gatA PE=3 SV=1 193 346 5.0E-11
sp|Q577Z3|GATA_BRUAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus biovar 1 (strain 9-941) GN=gatA PE=3 SV=1 173 349 5.0E-11
sp|Q2YKL3|GATA_BRUA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus (strain 2308) GN=gatA PE=3 SV=1 173 349 5.0E-11
sp|B2SB62|GATA_BRUA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus (strain S19) GN=gatA PE=3 SV=1 173 349 5.0E-11
sp|Q92QK7|GATA_RHIME Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium meliloti (strain 1021) GN=gatA PE=3 SV=1 193 349 5.0E-11
sp|A8F5H6|GATA_PSELT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gatA PE=3 SV=1 190 349 5.0E-11
sp|A4YWF1|GATA_BRASO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bradyrhizobium sp. (strain ORS278) GN=gatA PE=3 SV=1 192 372 5.0E-11
sp|Q5FLL1|GATA_LACAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gatA PE=3 SV=1 183 346 5.0E-11
sp|B2IEA4|GATA_BEII9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gatA PE=3 SV=1 169 372 5.0E-11
sp|Q2S4S2|GATA_SALRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gatA PE=3 SV=1 191 346 6.0E-11
sp|P52831|HYIN_PSESY Indoleacetamide hydrolase OS=Pseudomonas syringae pv. syringae GN=iaaH PE=3 SV=1 193 389 6.0E-11
sp|A4IVY3|GATA_FRATW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gatA PE=3 SV=1 190 344 6.0E-11
sp|B2SEM6|GATA_FRATM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gatA PE=3 SV=1 190 344 6.0E-11
sp|Q8G768|GATA_BIFLO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum (strain NCC 2705) GN=gatA PE=3 SV=1 193 346 6.0E-11
sp|B3DU32|GATA_BIFLD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum (strain DJO10A) GN=gatA PE=3 SV=1 193 346 6.0E-11
sp|C1FLD9|GATA_CLOBJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Kyoto / Type A2) GN=gatA PE=3 SV=1 191 347 6.0E-11
sp|C3KU97|GATA_CLOB6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain 657 / Type Ba4) GN=gatA PE=3 SV=1 191 347 6.0E-11
sp|B7KWB0|GATA_METC4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=gatA PE=3 SV=1 171 383 6.0E-11
sp|A1WVR7|GATA_HALHL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gatA PE=3 SV=1 192 346 6.0E-11
sp|Q93LE2|GATA_GEOSE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus stearothermophilus GN=gatA PE=3 SV=1 192 346 6.0E-11
sp|B7GTU6|GATA_BIFLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=gatA PE=3 SV=1 193 346 7.0E-11
sp|O84006|GATA_CHLTR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gatA PE=3 SV=1 193 342 7.0E-11
sp|Q3KN19|GATA_CHLTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gatA PE=3 SV=1 193 342 7.0E-11
sp|Q5AQN0|GATA_EMENI Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN9400 PE=3 SV=2 193 361 7.0E-11
sp|B0BAY9|GATA_CHLTB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gatA PE=3 SV=1 193 342 7.0E-11
sp|B0B9B0|GATA_CHLT2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gatA PE=3 SV=1 193 342 7.0E-11
sp|Q8RC40|GATA_CALS4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gatA PE=3 SV=1 191 361 7.0E-11
sp|Q6FZS9|GATA_BARQU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella quintana (strain Toulouse) GN=gatA PE=3 SV=1 173 349 7.0E-11
sp|Q3SM39|GATA_THIDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gatA PE=3 SV=1 192 345 8.0E-11
sp|A7IMA7|GATA_XANP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gatA PE=3 SV=1 148 346 8.0E-11
sp|Q67KJ2|GATA_SYMTH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gatA PE=3 SV=1 181 347 8.0E-11
sp|Q74I52|GATA_LACJO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gatA PE=3 SV=1 190 346 9.0E-11
sp|Q1GFB5|GATA_RUEST Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruegeria sp. (strain TM1040) GN=gatA PE=3 SV=1 151 371 9.0E-11
sp|B0K3S3|GATA_THEPX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermoanaerobacter sp. (strain X514) GN=gatA PE=3 SV=1 186 361 9.0E-11
sp|Q5XAC7|GATA_STRP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gatA PE=3 SV=1 193 342 1.0E-10
sp|O06491|GATA_BACSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus subtilis (strain 168) GN=gatA PE=3 SV=3 193 346 1.0E-10
sp|A5CEC8|GATA_ORITB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Orientia tsutsugamushi (strain Boryong) GN=gatA PE=3 SV=1 170 346 1.0E-10
sp|B4R968|GATA_PHEZH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Phenylobacterium zucineum (strain HLK1) GN=gatA PE=3 SV=1 131 346 1.0E-10
sp|Q8NZM0|GATA_STRP8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gatA PE=3 SV=1 193 342 1.0E-10
sp|B9JVJ1|GATA_AGRVS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gatA PE=3 SV=1 173 349 1.0E-10
sp|P0CZ61|GATA_STRPQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gatA PE=3 SV=1 193 342 1.0E-10
sp|Q1JKC7|GATA_STRPC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gatA PE=3 SV=1 193 342 1.0E-10
sp|Q1JA74|GATA_STRPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=gatA PE=3 SV=1 193 342 1.0E-10
sp|P0CZ60|GATA_STRP3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gatA PE=3 SV=1 193 342 1.0E-10
sp|B8FCK9|GATA_DESAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfatibacillum alkenivorans (strain AK-01) GN=gatA PE=3 SV=1 192 346 1.0E-10
sp|B1INF7|GATA_CLOBK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Okra / Type B1) GN=gatA PE=3 SV=1 191 347 1.0E-10
sp|A9A9F2|GATA_METM6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=gatA PE=3 SV=1 191 347 1.0E-10
sp|Q48RQ4|GATA_STRPM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gatA PE=3 SV=1 193 342 1.0E-10
sp|A4IJZ2|GATA_GEOTN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gatA PE=3 SV=1 192 346 1.0E-10
sp|Q1J569|GATA_STRPF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gatA PE=3 SV=1 193 342 1.0E-10
sp|C5D4K6|GATA_GEOSW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus sp. (strain WCH70) GN=gatA PE=3 SV=1 193 346 1.0E-10
sp|Q313S5|GATA_DESAG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio alaskensis (strain G20) GN=gatA PE=3 SV=1 189 346 1.0E-10
sp|A7GIK2|GATA_CLOBL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gatA PE=3 SV=1 191 347 1.0E-10
sp|Q58560|GATA_METJA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=gatA PE=3 SV=1 186 346 1.0E-10
sp|B0KBN4|GATA_THEP3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gatA PE=3 SV=1 193 361 1.0E-10
sp|B3QYQ7|GATA_CHLT3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gatA PE=3 SV=1 151 417 1.0E-10
sp|Q83HX2|GATA_TROW8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Tropheryma whipplei (strain TW08/27) GN=gatA PE=3 SV=2 186 342 1.0E-10
sp|A5I6Z3|GATA_CLOBH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gatA PE=3 SV=1 191 347 1.0E-10
sp|A7FYL3|GATA_CLOB1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gatA PE=3 SV=1 191 347 1.0E-10
sp|Q83GA1|GATA_TROWT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Tropheryma whipplei (strain Twist) GN=gatA PE=3 SV=1 186 342 1.0E-10
sp|C0QKZ5|GATA_DESAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=gatA PE=3 SV=1 192 361 1.0E-10
sp|B7GFW3|GATA_ANOFW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=gatA PE=3 SV=1 193 346 1.0E-10
sp|A5CX65|GATA_VESOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=gatA PE=3 SV=1 193 346 1.0E-10
sp|Q5L3B3|GATA_GEOKA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus kaustophilus (strain HTA426) GN=gatA PE=3 SV=1 192 346 2.0E-10
sp|Q8Y6D2|GATA_LISMO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gatA PE=3 SV=1 189 347 2.0E-10
sp|Q9HVT8|GATA_PSEAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gatA PE=1 SV=1 193 346 2.0E-10
sp|A6U819|GATA_SINMW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sinorhizobium medicae (strain WSM419) GN=gatA PE=3 SV=1 193 349 2.0E-10
sp|B1L1G9|GATA_CLOBM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gatA PE=3 SV=1 191 347 2.0E-10
sp|A0AJK8|GATA_LISW6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gatA PE=3 SV=1 189 347 2.0E-10
sp|A8YTZ6|GATA_LACH4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus helveticus (strain DPC 4571) GN=gatA PE=3 SV=1 190 346 2.0E-10
sp|Q92AQ3|GATA_LISIN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gatA PE=3 SV=1 189 347 2.0E-10
sp|B8DFG8|GATA_LISMH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gatA PE=3 SV=1 189 347 2.0E-10
sp|A1UT20|GATA_BARBK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gatA PE=3 SV=1 173 349 2.0E-10
sp|Q215W8|GATA_RHOPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopseudomonas palustris (strain BisB18) GN=gatA PE=3 SV=1 192 349 2.0E-10
sp|Q3J7V7|GATA_NITOC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gatA PE=3 SV=1 193 346 2.0E-10
sp|Q02GV8|GATA_PSEAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gatA PE=3 SV=1 193 346 2.0E-10
sp|B7V023|GATA_PSEA8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain LESB58) GN=gatA PE=3 SV=1 193 346 2.0E-10
sp|B1ZLM1|GATA_METPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gatA PE=3 SV=1 171 383 2.0E-10
sp|Q98M95|GATA_RHILO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium loti (strain MAFF303099) GN=gatA PE=3 SV=1 173 349 2.0E-10
sp|Q89K29|GATA_BRADU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gatA PE=3 SV=1 186 372 2.0E-10
sp|C0R074|GATA_BRAHW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=gatA PE=3 SV=1 192 372 2.0E-10
sp|Q03EG5|GATA_PEDPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=gatA PE=3 SV=1 189 346 2.0E-10
sp|Q4KIA8|GATA_PSEF5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gatA PE=3 SV=1 193 346 2.0E-10
sp|Q3J459|GATA_RHOS4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gatA PE=3 SV=1 193 372 2.0E-10
sp|B9DVG6|GATA_STRU0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=gatA PE=3 SV=1 189 342 2.0E-10
sp|B8GL95|GATA_THISH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=gatA PE=3 SV=1 173 345 2.0E-10
sp|Q75D84|GATA_ASHGO Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HER2 PE=3 SV=2 190 383 3.0E-10
sp|B9KPF8|GATA_RHOSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=gatA PE=3 SV=1 193 372 3.0E-10
sp|Q1GYD3|GATA_METFK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gatA PE=3 SV=1 192 345 3.0E-10
sp|A3PI90|GATA_RHOS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gatA PE=3 SV=1 193 372 3.0E-10
sp|Q4ZNS7|GATA_PSEU2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gatA PE=3 SV=1 192 346 3.0E-10
sp|Q2YU51|GATA_STAAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gatA PE=3 SV=1 193 349 3.0E-10
sp|Q0BTK2|GATA_GRABC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=gatA PE=3 SV=1 193 361 3.0E-10
sp|Q1JFB9|GATA_STRPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gatA PE=3 SV=1 193 342 3.0E-10
sp|Q31F53|GATA_THICR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thiomicrospira crunogena (strain XCL-2) GN=gatA PE=3 SV=1 193 346 3.0E-10
sp|A7GKK3|GATA_BACCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gatA PE=3 SV=1 132 346 3.0E-10
sp|B9DMT8|GATA_STACT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus carnosus (strain TM300) GN=gatA PE=3 SV=1 193 383 3.0E-10
sp|C1KW54|GATA_LISMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gatA PE=3 SV=1 189 347 4.0E-10
sp|Q47860|HYIN_PANAY Indoleacetamide hydrolase OS=Pantoea agglomerans pv. gypsophilae GN=iaaH PE=3 SV=1 193 373 4.0E-10
sp|B2TIZ9|GATA_CLOBB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=gatA PE=3 SV=1 193 373 4.0E-10
sp|A4VT83|GATA_STRSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus suis (strain 05ZYH33) GN=gatA PE=3 SV=1 193 369 4.0E-10
sp|A4VZG5|GATA_STRS2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus suis (strain 98HAH33) GN=gatA PE=3 SV=1 193 369 4.0E-10
sp|A9IU58|GATA_BART1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gatA PE=3 SV=1 173 349 4.0E-10
sp|Q71YR3|GATA_LISMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gatA PE=3 SV=1 189 347 4.0E-10
sp|B2UZ26|GATA_CLOBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=gatA PE=3 SV=1 193 373 4.0E-10
sp|A7Z267|GATA_BACMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gatA PE=3 SV=1 136 346 5.0E-10
sp|Q6LX43|GATA_METMP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain S2 / LL) GN=gatA PE=3 SV=1 191 347 5.0E-10
sp|A2RCV7|GATA_STRPG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gatA PE=3 SV=1 193 342 5.0E-10
sp|Q7VCJ0|GATA_PROMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gatA PE=3 SV=1 192 388 5.0E-10
sp|Q9PL37|GATA_CHLMU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gatA PE=3 SV=1 189 342 5.0E-10
sp|A6VBJ8|GATA_PSEA7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain PA7) GN=gatA PE=3 SV=1 193 346 5.0E-10
sp|A9W748|GATA_METEP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium extorquens (strain PA1) GN=gatA PE=3 SV=1 171 383 5.0E-10
sp|P84650|AMID_RHORH Enantioselective amidase OS=Rhodococcus rhodochrous GN=amdA PE=1 SV=1 186 346 5.0E-10
sp|A1K1T5|GATA_AZOSB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azoarcus sp. (strain BH72) GN=gatA PE=3 SV=1 192 342 6.0E-10
sp|A4FW11|GATA_METM5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=gatA PE=3 SV=1 191 347 6.0E-10
sp|Q6GFF7|GATA_STAAR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MRSA252) GN=gatA PE=3 SV=1 193 349 6.0E-10
sp|B2S4Q7|GATA_TREPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gatA PE=3 SV=1 191 345 6.0E-10
sp|O83983|GATA_TREPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Treponema pallidum (strain Nichols) GN=gatA PE=3 SV=1 191 345 6.0E-10
sp|P63489|GATA_STAAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain N315) GN=gatA PE=1 SV=1 193 349 6.0E-10
sp|P63488|GATA_STAAM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gatA PE=1 SV=1 193 349 6.0E-10
sp|A7X427|GATA_STAA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gatA PE=3 SV=1 193 349 6.0E-10
sp|A8Z2R4|GATA_STAAT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gatA PE=3 SV=1 193 349 7.0E-10
sp|A6QIC8|GATA_STAAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Newman) GN=gatA PE=3 SV=1 193 349 7.0E-10
sp|Q5HEM2|GATA_STAAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain COL) GN=gatA PE=3 SV=1 193 349 7.0E-10
sp|Q2FWY9|GATA_STAA8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain NCTC 8325) GN=gatA PE=3 SV=1 193 349 7.0E-10
sp|Q2FFJ5|GATA_STAA3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain USA300) GN=gatA PE=3 SV=1 193 349 7.0E-10
sp|Q49091|GATA_MORCA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Moraxella catarrhalis GN=gatA PE=3 SV=1 156 346 7.0E-10
sp|A6UQF6|GATA_METVS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gatA PE=3 SV=1 186 346 7.0E-10
sp|Q2NHN5|GATA_METST Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=gatA PE=3 SV=1 193 347 7.0E-10
sp|B5XHZ9|GATA_STRPZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gatA PE=3 SV=1 193 342 7.0E-10
sp|B3EA24|GATA_GEOLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gatA PE=3 SV=1 192 347 9.0E-10
sp|Q47SC3|GATA_THEFY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermobifida fusca (strain YX) GN=gatA PE=3 SV=1 192 347 9.0E-10
sp|B0TWN0|GATA_FRAP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gatA PE=3 SV=1 190 344 9.0E-10
sp|Q7WEV1|GATA_BORBR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gatA PE=3 SV=1 192 345 1.0E-09
sp|A9I0H5|GATA_BORPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gatA PE=3 SV=1 192 345 1.0E-09
sp|Q7W3H7|GATA_BORPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gatA PE=3 SV=1 192 345 1.0E-09
sp|A4WUQ2|GATA_RHOS5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gatA PE=3 SV=1 193 372 1.0E-09
sp|A6TTJ8|GATA_ALKMQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alkaliphilus metalliredigens (strain QYMF) GN=gatA PE=3 SV=1 193 361 1.0E-09
sp|C7YSE7|GATA_NECH7 Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_104567 PE=3 SV=1 224 347 1.0E-09
sp|Q8NVT3|GATA_STAAW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MW2) GN=gatA PE=3 SV=1 193 349 1.0E-09
sp|Q6G833|GATA_STAAS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MSSA476) GN=gatA PE=3 SV=1 193 349 1.0E-09
sp|A5IU67|GATA_STAA9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain JH9) GN=gatA PE=3 SV=1 193 349 1.0E-09
sp|A6U305|GATA_STAA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain JH1) GN=gatA PE=3 SV=1 193 349 1.0E-09
sp|Q7UT33|GATA_RHOBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gatA PE=3 SV=1 192 342 1.0E-09
sp|Q6C0M4|GATA_YARLI Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HER2 PE=3 SV=1 193 358 1.0E-09
sp|Q3KI27|GATA_PSEPF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain Pf0-1) GN=gatA PE=3 SV=1 193 346 1.0E-09
sp|Q7XJJ7|FAAH_ARATH Fatty acid amide hydrolase OS=Arabidopsis thaliana GN=FAAH PE=1 SV=1 181 345 1.0E-09
sp|Q7VSN2|GATA_BORPE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gatA PE=3 SV=1 192 345 1.0E-09
sp|P9WQ93|AMI4_MYCTU Putative amidase AmiD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=amiD PE=1 SV=1 193 346 1.0E-09
sp|P9WQ92|AMI4_MYCTO Putative amidase AmiD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=amiD PE=3 SV=1 193 346 1.0E-09
sp|P63497|AMI4_MYCBO Putative amidase AmiD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=amiD PE=3 SV=1 193 346 1.0E-09
sp|Q2T293|GATA_BURTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gatA PE=3 SV=1 192 346 1.0E-09
sp|C3K6Y4|GATA_PSEFS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain SBW25) GN=gatA PE=3 SV=1 190 346 1.0E-09
sp|Q63GR0|GATA_BACCZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ZK / E33L) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|B7H4W2|GATA_BACC4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain B4264) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|B7IUX9|GATA_BACC2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain G9842) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|B9J1N0|GATA_BACCQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain Q1) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|B7HSY0|GATA_BACC7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain AH187) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|Q73EK8|GATA_BACC1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|Q81IN3|GATA_BACCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|A4XQK6|GATA_PSEMY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas mendocina (strain ymp) GN=gatA PE=3 SV=1 193 347 2.0E-09
sp|Q6HP81|GATA_BACHK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|C1EV88|GATA_BACC3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain 03BB102) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|A0R921|GATA_BACAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus thuringiensis (strain Al Hakam) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|P06618|HYIN_PSESS Indoleacetamide hydrolase OS=Pseudomonas savastanoi GN=iaaH PE=3 SV=1 192 389 2.0E-09
sp|B2GDS6|GATA_LACF3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=gatA PE=3 SV=1 190 346 2.0E-09
sp|B7JMB2|GATA_BACC0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain AH820) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|Q81ZE8|GATA_BACAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|C3L559|GATA_BACAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|C3PBQ4|GATA_BACAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis (strain A0248) GN=gatA PE=3 SV=1 132 346 2.0E-09
sp|Q6NHQ1|GATA_CORDI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=gatA PE=3 SV=1 176 346 2.0E-09
sp|Q041K5|GATA_LACGA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=gatA PE=3 SV=1 190 346 2.0E-09
sp|Q8DSG5|GATA_STRMU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gatA PE=3 SV=1 193 342 2.0E-09
sp|Q9RF07|GATA_STAAU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus GN=gatA PE=3 SV=1 193 349 2.0E-09
sp|Q146Y5|GATA_BURXL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia xenovorans (strain LB400) GN=gatA PE=3 SV=1 192 346 2.0E-09
sp|Q1IED3|GATA_PSEE4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas entomophila (strain L48) GN=gatA PE=3 SV=1 193 346 2.0E-09
sp|B1HTW9|GATA_LYSSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lysinibacillus sphaericus (strain C3-41) GN=gatA PE=3 SV=1 192 347 2.0E-09
sp|B2V855|GATA_SULSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=gatA PE=3 SV=1 193 346 3.0E-09
sp|A5VZ22|GATA_PSEP1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gatA PE=3 SV=1 193 346 3.0E-09
sp|Q837V3|GATA_ENTFA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gatA PE=3 SV=1 188 349 3.0E-09
sp|Q88PB9|GATA_PSEPK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain KT2440) GN=gatA PE=3 SV=1 193 346 3.0E-09
sp|B0KQG0|GATA_PSEPG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain GB-1) GN=gatA PE=3 SV=1 193 346 3.0E-09
sp|A9VRH7|GATA_BACWK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus weihenstephanensis (strain KBAB4) GN=gatA PE=3 SV=1 132 346 3.0E-09
sp|C1C5H2|GATA_STRP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain 70585) GN=gatA PE=3 SV=1 193 372 3.0E-09
sp|Q2W6Y6|GATA_MAGSA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gatA PE=3 SV=2 193 387 3.0E-09
sp|C1CIT8|GATA_STRZP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain P1031) GN=gatA PE=3 SV=1 193 342 3.0E-09
sp|B1I9M8|GATA_STRPI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gatA PE=3 SV=1 193 342 3.0E-09
sp|B5E1P7|GATA_STRP4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gatA PE=3 SV=1 193 342 3.0E-09
sp|B1JDP1|GATA_PSEPW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain W619) GN=gatA PE=3 SV=1 193 346 3.0E-09
sp|B2ILX8|GATA_STRPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain CGSP14) GN=gatA PE=3 SV=1 193 342 4.0E-09
sp|C1DQ37|GATA_AZOVD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=gatA PE=3 SV=1 193 346 4.0E-09
sp|C1CPU7|GATA_STRZT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=gatA PE=3 SV=1 193 342 4.0E-09
sp|Q8DR10|GATA_STRR6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gatA PE=3 SV=1 193 342 4.0E-09
sp|B8ZLK1|GATA_STRPJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=gatA PE=3 SV=1 193 342 4.0E-09
sp|Q04M41|GATA_STRP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gatA PE=3 SV=1 193 342 4.0E-09
sp|Q65MP8|GATA_BACLD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gatA PE=3 SV=1 193 346 4.0E-09
sp|Q5P4D0|GATA_AROAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aromatoleum aromaticum (strain EbN1) GN=gatA PE=3 SV=1 192 342 4.0E-09
sp|Q8E3P4|GATA_STRA3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gatA PE=3 SV=1 193 370 4.0E-09
sp|Q8DY25|GATA_STRA5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gatA PE=3 SV=1 193 370 4.0E-09
sp|Q3JZM1|GATA_STRA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gatA PE=3 SV=1 193 370 4.0E-09
sp|C5P3I5|GATA_COCP7 Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Coccidioides posadasii (strain C735) GN=CPC735_061260 PE=3 SV=1 189 383 4.0E-09
sp|C0QRF9|GATA_PERMH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=gatA PE=3 SV=1 186 346 4.0E-09
sp|Q6G3E9|GATA_BARHE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gatA PE=3 SV=1 173 349 5.0E-09
sp|Q8R679|GATA_FUSNN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gatA PE=3 SV=1 193 346 5.0E-09
sp|Q2KU72|GATA_BORA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bordetella avium (strain 197N) GN=gatA PE=3 SV=1 192 345 5.0E-09
sp|Q8Y3C3|GATA_RALSO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ralstonia solanacearum (strain GMI1000) GN=gatA PE=3 SV=1 192 346 5.0E-09
sp|Q9Z9W9|GATA_BACHD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gatA PE=3 SV=1 193 375 5.0E-09
sp|A8G4M8|GATA_PROM2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9215) GN=gatA PE=3 SV=1 182 342 5.0E-09
sp|A1AW13|GATA_RUTMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gatA PE=3 SV=1 193 346 6.0E-09
sp|C1CCK0|GATA_STRZJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain JJA) GN=gatA PE=3 SV=1 193 342 6.0E-09
sp|Q97SE6|GATA_STRPN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gatA PE=1 SV=1 193 342 6.0E-09
sp|B2G8T6|GATA_LACRJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus reuteri (strain JCM 1112) GN=gatA PE=3 SV=1 188 349 6.0E-09
sp|A5VLG3|GATA_LACRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus reuteri (strain DSM 20016) GN=gatA PE=3 SV=1 188 349 6.0E-09
sp|Q1AXT0|GATA_RUBXD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=gatA PE=3 SV=1 191 349 6.0E-09
sp|B2T1M4|GATA_BURPP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gatA PE=3 SV=1 192 346 7.0E-09
sp|Q7NKF0|GATA_GLOVI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Gloeobacter violaceus (strain PCC 7421) GN=gatA PE=3 SV=1 193 346 7.0E-09
sp|Q8CRU3|GATA_STAES Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gatA PE=3 SV=1 193 349 7.0E-09
sp|Q5HN34|GATA_STAEQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gatA PE=3 SV=1 193 349 7.0E-09
sp|B4S4W1|GATA_PROA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gatA PE=3 SV=1 176 417 8.0E-09
sp|Q99YC0|GATA_STRP1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M1 GN=gatA PE=3 SV=1 193 342 1.0E-08
sp|Q49YU4|GATA_STAS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gatA PE=3 SV=1 193 346 1.0E-08
sp|A6VWN0|GATA_MARMS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Marinomonas sp. (strain MWYL1) GN=gatA PE=3 SV=1 193 449 1.0E-08
sp|A8FAS0|GATA_BACP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus pumilus (strain SAFR-032) GN=gatA PE=3 SV=1 193 347 1.0E-08
sp|Q0KFF8|GATA_CUPNH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=gatA PE=3 SV=1 192 345 1.0E-08
sp|Q4L7L4|GATA_STAHJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gatA PE=3 SV=1 193 349 1.0E-08
sp|C4XQ59|GATA_DESMR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=gatA PE=3 SV=1 189 346 1.0E-08
sp|Q9X0Z9|GATA_THEMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gatA PE=1 SV=1 195 349 1.0E-08
sp|A7HX17|GATA_PARL1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gatA PE=3 SV=1 130 349 1.0E-08
sp|Q7SHZ2|GATA_NEUCR Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU00660 PE=3 SV=2 209 349 1.0E-08
sp|Q8ES78|GATA_OCEIH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gatA PE=3 SV=1 193 373 1.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6460
MKPVHLASLALQFPTTIAHVFFSTGSTVSLNDVPYYVPPDAVANVSAISKNLTQNGDLVPVTFLSSNAASLSLRD
LQERLLLFSQADDVFQQGFTQVVYLQHQGAINAASFGNVTVISSPNTNIANGPYFASAKGLVHKAYRLYADVQGA
FTETSVPRADGSHTVLPANVPGQSLAIAVPSRLYYSKTPQQPLAGVRLGVKDIFDVRGLRTSNGNRAWYHLYPPA
EHTAIAVQNLVDAGAVIVGKMKTSQFANGETATADWVEYHAPFNPRGDGYQDPSSSSAGPAAGEAAYPWLDIALG
SDTGGSIRTPSQLQGLYGNRPSHGLVSLSGTMPLSPQFDTAGLLARDPRLWRAAARMLYGHSMPTASNTSFPSNL
LTVGFPTEAESDHDVILLQFLSRLQSFLGAKVVPWNIAQSWWLSNPDSPELQLFVNNTYEVLSAQDQAHLVRDGF
LAAYAASHAGRQPHINPAPVQRWALADSTGRTASTSAKATASKKRFAAWFNSSVLSSCSDRLVVYVPRIPKSVYR
GAYRRGPSLPQPFGMSRVSVLSGAPEVAVPIGEVMRI*
Coding >OphauB2|6460
ATGAAGCCAGTTCATCTTGCGTCTCTCGCGTTGCAATTTCCCACCACCATTGCCCATGTCTTCTTTTCCACTGGC
TCAACCGTCAGCCTCAATGACGTGCCTTATTATGTGCCACCTGATGCTGTGGCTAACGTCTCCGCCATTTCGAAA
AATCTCACTCAAAACGGCGACTTGGTGCCTGTAACTTTCTTGAGTAGCAACGCAGCCTCCCTTTCTCTTCGCGAT
TTACAGGAGCGCCTTTTACTATTCTCACAGGCCGATGACGTCTTTCAACAAGGCTTCACACAAGTCGTCTACCTT
CAACATCAGGGTGCCATCAACGCTGCGTCGTTTGGCAATGTTACTGTAATCAGCAGTCCAAATACCAACATAGCC
AACGGTCCCTACTTTGCATCCGCCAAAGGCCTTGTCCACAAGGCATATCGCCTCTATGCCGATGTTCAAGGCGCC
TTTACTGAGACGTCTGTGCCCCGTGCCGACGGTTCCCACACCGTGCTTCCGGCCAACGTGCCCGGGCAGTCTCTT
GCCATTGCTGTCCCGTCACGCCTCTACTATTCCAAAACACCACAGCAACCACTTGCTGGAGTACGCTTGGGTGTC
AAGGACATCTTTGACGTACGCGGTTTGCGAACCTCCAATGGCAACCGCGCGTGGTATCATCTATATCCGCCGGCA
GAGCACACGGCCATTGCTGTTCAAAACCTCGTTGATGCTGGAGCCGTCATTGTAGGCAAAATGAAGACAAGCCAG
TTTGCAAACGGCGAAACAGCCACGGCGGACTGGGTCGAGTATCACGCTCCGTTTAATCCTCGCGGAGACGGCTAT
CAAGACCCGTCATCGTCTTCTGCGGGGCCAGCTGCAGGAGAAGCCGCGTACCCGTGGCTCGATATAGCGCTAGGG
TCAGATACAGGCGGCAGCATTCGGACTCCAAGCCAGCTCCAGGGATTATACGGAAATAGACCAAGCCATGGTCTC
GTATCGCTGTCTGGAACAATGCCCCTGAGTCCACAGTTTGATACGGCCGGCTTGCTTGCGCGGGATCCCAGACTA
TGGAGAGCTGCGGCCCGCATGCTCTATGGCCATAGTATGCCGACTGCTAGCAACACTTCGTTCCCCTCGAATCTT
CTTACCGTCGGATTTCCCACAGAGGCCGAGTCGGATCATGATGTCATATTGCTGCAGTTTCTATCTCGCTTACAA
TCTTTTCTCGGAGCCAAGGTTGTGCCTTGGAACATAGCTCAAAGCTGGTGGTTGTCTAATCCAGACTCGCCAGAG
CTACAACTGTTCGTCAATAATACTTACGAAGTACTCTCAGCGCAAGACCAGGCTCATCTTGTCAGAGATGGCTTC
TTGGCAGCCTATGCAGCATCACACGCTGGTCGTCAACCACACATCAATCCTGCGCCAGTGCAGCGTTGGGCTCTT
GCTGACAGTACTGGCCGTACTGCATCCACCAGTGCAAAGGCGACAGCTAGTAAGAAACGCTTTGCTGCTTGGTTC
AACAGCAGTGTTCTCTCGTCGTGTTCAGACCGGCTTGTCGTATACGTGCCCCGCATACCAAAAAGTGTCTATCGC
GGCGCGTATAGACGTGGCCCTTCTCTTCCTCAGCCATTTGGTATGAGCCGCGTATCTGTCCTCAGCGGTGCACCA
GAAGTAGCAGTGCCGATAGGAGAGGTGATGCGCATTTAG
Transcript >OphauB2|6460
ATGAAGCCAGTTCATCTTGCGTCTCTCGCGTTGCAATTTCCCACCACCATTGCCCATGTCTTCTTTTCCACTGGC
TCAACCGTCAGCCTCAATGACGTGCCTTATTATGTGCCACCTGATGCTGTGGCTAACGTCTCCGCCATTTCGAAA
AATCTCACTCAAAACGGCGACTTGGTGCCTGTAACTTTCTTGAGTAGCAACGCAGCCTCCCTTTCTCTTCGCGAT
TTACAGGAGCGCCTTTTACTATTCTCACAGGCCGATGACGTCTTTCAACAAGGCTTCACACAAGTCGTCTACCTT
CAACATCAGGGTGCCATCAACGCTGCGTCGTTTGGCAATGTTACTGTAATCAGCAGTCCAAATACCAACATAGCC
AACGGTCCCTACTTTGCATCCGCCAAAGGCCTTGTCCACAAGGCATATCGCCTCTATGCCGATGTTCAAGGCGCC
TTTACTGAGACGTCTGTGCCCCGTGCCGACGGTTCCCACACCGTGCTTCCGGCCAACGTGCCCGGGCAGTCTCTT
GCCATTGCTGTCCCGTCACGCCTCTACTATTCCAAAACACCACAGCAACCACTTGCTGGAGTACGCTTGGGTGTC
AAGGACATCTTTGACGTACGCGGTTTGCGAACCTCCAATGGCAACCGCGCGTGGTATCATCTATATCCGCCGGCA
GAGCACACGGCCATTGCTGTTCAAAACCTCGTTGATGCTGGAGCCGTCATTGTAGGCAAAATGAAGACAAGCCAG
TTTGCAAACGGCGAAACAGCCACGGCGGACTGGGTCGAGTATCACGCTCCGTTTAATCCTCGCGGAGACGGCTAT
CAAGACCCGTCATCGTCTTCTGCGGGGCCAGCTGCAGGAGAAGCCGCGTACCCGTGGCTCGATATAGCGCTAGGG
TCAGATACAGGCGGCAGCATTCGGACTCCAAGCCAGCTCCAGGGATTATACGGAAATAGACCAAGCCATGGTCTC
GTATCGCTGTCTGGAACAATGCCCCTGAGTCCACAGTTTGATACGGCCGGCTTGCTTGCGCGGGATCCCAGACTA
TGGAGAGCTGCGGCCCGCATGCTCTATGGCCATAGTATGCCGACTGCTAGCAACACTTCGTTCCCCTCGAATCTT
CTTACCGTCGGATTTCCCACAGAGGCCGAGTCGGATCATGATGTCATATTGCTGCAGTTTCTATCTCGCTTACAA
TCTTTTCTCGGAGCCAAGGTTGTGCCTTGGAACATAGCTCAAAGCTGGTGGTTGTCTAATCCAGACTCGCCAGAG
CTACAACTGTTCGTCAATAATACTTACGAAGTACTCTCAGCGCAAGACCAGGCTCATCTTGTCAGAGATGGCTTC
TTGGCAGCCTATGCAGCATCACACGCTGGTCGTCAACCACACATCAATCCTGCGCCAGTGCAGCGTTGGGCTCTT
GCTGACAGTACTGGCCGTACTGCATCCACCAGTGCAAAGGCGACAGCTAGTAAGAAACGCTTTGCTGCTTGGTTC
AACAGCAGTGTTCTCTCGTCGTGTTCAGACCGGCTTGTCGTATACGTGCCCCGCATACCAAAAAGTGTCTATCGC
GGCGCGTATAGACGTGGCCCTTCTCTTCCTCAGCCATTTGGTATGAGCCGCGTATCTGTCCTCAGCGGTGCACCA
GAAGTAGCAGTGCCGATAGGAGAGGTGATGCGCATTTAG
Gene >OphauB2|6460
ATGAAGCCAGTTCATCTTGCGTCTCTCGCGTTGCAATTTCCCACCACCATTGCCCATGTCTTCTTTTCCACTGGC
TCAACCGTCAGCCTCAATGACGTGCCTTATTATGTGCCACCTGATGCTGTGGCTAACGTCTCCGCCATTTCGAAA
AATCTCACTCAAAACGGCGACTTGGTGCCTGTAACTTTCTTGAGTAGCAACGCAGCCTCCCTTTCTCTTCGCGAT
TTACAGGAGCGCCTTTTACTATTCTCACAGGCCGATGACGTCTTTCAACAAGGCTTCACACAAGGTACATGGCCA
TTGACCTAGCCACGCTTAATCCCTCACTTCCGCCCTCTCTCTTCCTCTCTCTCCTATGGTTTTTTTTCTTTGTGT
GCCCCAACTCTCGTCTACTCCAACTAATTCTCCTCCTTTAGTCGTCTACCTTCAACATCAGGGTGCCATCAACGC
TGCGTCGTTTGGCAATGTTACTGTAATCAGCAGTCCAAATACCAACATAGCCAACGGTCCCTACTTTGCATCCGC
CAAAGGCCTTGTCCACAAGGCATATCGCCTCTATGCCGATGTTCAAGGCGCCTTTACTGAGACGTCTGTGCCCCG
TGCCGACGGTTCCCACACCGTGCTTCCGGCCAACGTGCCCGGGCAGTCTCTTGCCATTGCTGTCCCGTCACGCCT
CTACTATTCCAAAACACCACAGCAACCACTTGCTGGAGTACGCTTGGGTGTCAAGGACATCTTTGACGTACGCGG
TTTGCGAACCTCCAATGGCAACCGCGCGTGGTATCATCTATATCCGCCGGCAGAGCACACGGCCATTGCTGTTCA
AAACCTCGTTGATGCTGGAGCCGTCATTGTAGGCAAAATGAAGACAAGCCAGTTTGCAAACGGCGAAACAGCCAC
GGCGGACTGGGTCGAGTATCACGCTCCGTTTAATCCTCGCGGAGACGGCTATCAAGACCCGTCATCGTCTTCTGC
GGGGCCAGCTGCAGGAGAAGGTATGCATGGCATATATTATACTCTTTGTCAGAGGCCCCATGCTGAGGACTAAAC
AGCCGCGTACCCGTGGCTCGATATAGCGCTAGGGTCAGATACAGGCGGCAGCATTCGGACTCCAAGCCAGCTCCA
GGGATTATACGGAAATAGACCAAGTAAGCAAATGTCGCTTCGGCAAGTTTATGGGCCCTGACGCTGGATTCAAGG
CCATGGTCTCGTATCGCTGTCTGGAACAATGCCCCTGAGTCCACAGTTTGATACGGCCGGCTTGCTTGCGCGGGA
TCCCAGACTATGGAGAGCTGCGGCCCGCATGCTCTATGGCCATAGTATGCCGACTGCTAGCAACACTTCGTTCCC
CTCGAATCTTCTTACCGTCGGATTTCCCACAGAGGCCGAGTCGGATCATGATGTCATATTGCTGCAGTTTCTATC
TCGCTTACAATCTTTTCTCGGAGCCAAGGTTGTGCCTTGGAACATAGCTCAAAGCTGGTGGTTGTCTAATCCAGA
CTCGCCAGAGCTACAACTGTTCGTCAATAATACTTACGAAGTACTCTCAGCGCAAGACCAGGCTCATCTTGTCAG
AGATGGCTTCTTGGCAGCCTATGCAGCATCACACGCTGGTCGTCAACCACACATCAATCCTGCGCCAGTGCAGCG
TTGGGCTCTTGCTGACAGTACTGGCCGTACTGCATCCACCAGTGCAAAGGCGACAGCTAGTAAGAAACGCTTTGC
TGCTTGGTTCAACAGCAGTGTTCTCTCGTCGTGTTCAGACCGGCTTGTCGTATACGTGCCCCGCATACCAAAAAG
TGTCTATCGCGGCGCGTATAGACGTGGCCCTTCTCTTCCTCAGCCATTTGGTATGAGCCGCGTATCTGTCCTCAG
CGGTGCACCAGAAGTAGCAGTGCCGATAGGAGAGGTGATGCGCATGTCAGTCGTTACGGGCAAGAAGGAGAGTAT
CCCAGTAGCAGTAGCACTGGTAGCGGCCCGGGGATGTGACGATATGCTATTTGCATTAGTTGAGGCGCTGCTAGA
CCAAGACATTGTGGCAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail