Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6459
Gene name
LocationContig_6:62847..64707
Strand-
Gene length (bp)1860
Transcript length (bp)1860
Coding sequence length (bp)1860
Protein length (aa) 620

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 6.6E-30 82 579
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.5E-05 77 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23623|OXLA_NEUCR L-amino-acid oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lox PE=1 SV=2 53 601 2.0E-97
sp|P86810|OXLA_SIGCA L-amino-acid oxidase OS=Siganus canaliculatus PE=1 SV=2 75 588 7.0E-23
sp|Q6STF1|OXLA_GLOHA L-amino-acid oxidase OS=Gloydius halys PE=1 SV=1 60 575 1.0E-18
sp|Q90W54|OXLA_GLOBL L-amino-acid oxidase OS=Gloydius blomhoffii PE=1 SV=1 60 575 2.0E-18
sp|P0DI84|OXLA_VIPAA L-amino-acid oxidase OS=Vipera ammodytes ammodytes PE=1 SV=1 60 573 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23623|OXLA_NEUCR L-amino-acid oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lox PE=1 SV=2 53 601 2.0E-97
sp|P86810|OXLA_SIGCA L-amino-acid oxidase OS=Siganus canaliculatus PE=1 SV=2 75 588 7.0E-23
sp|Q6STF1|OXLA_GLOHA L-amino-acid oxidase OS=Gloydius halys PE=1 SV=1 60 575 1.0E-18
sp|Q90W54|OXLA_GLOBL L-amino-acid oxidase OS=Gloydius blomhoffii PE=1 SV=1 60 575 2.0E-18
sp|P0DI84|OXLA_VIPAA L-amino-acid oxidase OS=Vipera ammodytes ammodytes PE=1 SV=1 60 573 7.0E-18
sp|P56742|OXLA_CROAT L-amino-acid oxidase OS=Crotalus atrox PE=1 SV=2 60 573 9.0E-18
sp|F8S0Z5|OXLA2_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 60 573 9.0E-18
sp|B5U6Y8|OXLA_ECHOC L-amino-acid oxidase OS=Echis ocellatus PE=1 SV=1 7 578 1.0E-17
sp|P81382|OXLA_CALRH L-amino-acid oxidase OS=Calloselasma rhodostoma PE=1 SV=2 7 575 2.0E-17
sp|O34363|YOBN_BACSU Putative L-amino-acid oxidase YobN OS=Bacillus subtilis (strain 168) GN=yobN PE=3 SV=3 57 574 2.0E-17
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 60 573 4.0E-17
sp|Q6WP39|OXLA_TRIST L-amino-acid oxidase OS=Trimeresurus stejnegeri PE=1 SV=1 60 573 5.0E-17
sp|Q4JHE1|OXLA_PSEAU L-amino-acid oxidase OS=Pseudechis australis PE=1 SV=1 60 573 6.0E-17
sp|J7H670|OXLA_LACMT L-amino acid oxidase Lm29 OS=Lachesis muta PE=1 SV=1 47 573 1.0E-16
sp|B0VXW0|OXLA_SISCA L-amino-acid oxidase OS=Sistrurus catenatus edwardsii PE=2 SV=1 7 573 1.0E-16
sp|O93364|OXLA_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 60 573 2.0E-16
sp|K9N7B7|OXLA_CRODM L-amino acid oxidase Cdc18 (Fragment) OS=Crotalus durissus cumanensis PE=1 SV=1 60 573 5.0E-16
sp|A8QL52|OXLA_BUNFA L-amino-acid oxidase OS=Bungarus fasciatus PE=1 SV=1 60 573 2.0E-15
sp|X2JCV5|OXLA_CERCE L-amino acid oxidase OS=Cerastes cerastes PE=1 SV=1 42 573 2.0E-15
sp|A0A024BTN9|OXLA_BOTSC L-amino acid oxidase Bs29 (Fragment) OS=Bothriechis schlegelii PE=1 SV=1 60 573 3.0E-15
sp|Q54EW2|Y9130_DICDI Putative bifunctional amine oxidase DDB_G0291301 OS=Dictyostelium discoideum GN=DDB_G0291301 PE=1 SV=1 63 596 3.0E-15
sp|B5AR80|OXLA_BOTPA L-amino-acid oxidase (Fragment) OS=Bothrops pauloensis PE=1 SV=1 60 573 3.0E-15
sp|A6MFL0|OXLA_DEMVE L-amino-acid oxidase OS=Demansia vestigiata PE=2 SV=1 60 575 3.0E-15
sp|G8XQX1|OXLA_DABRR L-amino-acid oxidase OS=Daboia russelii PE=1 SV=1 7 573 4.0E-15
sp|X2L4E2|OXLA_BOTPC L-amino acid oxidase (Fragment) OS=Bothrops pictus PE=2 SV=1 60 579 6.0E-15
sp|Q6TGQ8|OXLA_BOTMO L-amino-acid oxidase (Fragment) OS=Bothrops moojeni PE=1 SV=1 60 569 8.0E-15
sp|Q4JHE3|OXLA_OXYSC L-amino-acid oxidase OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 60 573 3.0E-14
sp|Q4JHE2|OXLA_NOTSC L-amino-acid oxidase OS=Notechis scutatus scutatus PE=2 SV=1 60 573 9.0E-14
sp|P81383|OXLA_OPHHA L-amino-acid oxidase OS=Ophiophagus hannah PE=1 SV=3 315 579 4.0E-13
sp|Q96RQ9|OXLA_HUMAN L-amino-acid oxidase OS=Homo sapiens GN=IL4I1 PE=1 SV=1 401 579 4.0E-12
sp|A8QL58|OXLA_NAJAT L-amino-acid oxidase (Fragment) OS=Naja atra PE=1 SV=1 60 519 9.0E-12
sp|Q8KHS0|REBO_NOCAE Flavin-dependent L-tryptophan oxidase RebO OS=Lechevalieria aerocolonigenes GN=rebO PE=1 SV=1 311 576 8.0E-10
sp|O09046|OXLA_MOUSE L-amino-acid oxidase OS=Mus musculus GN=Il4i1 PE=1 SV=1 401 579 9.0E-10
sp|Q4F867|OXLA_DABSI L-amino-acid oxidase (Fragments) OS=Daboia siamensis PE=1 SV=2 407 573 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6459
MASIWNLLVGALLCLAGSVLGNVVENQNGLYEGNQQGRNKQQHPLLEDFDALGAWFDQVDSIKATTAPRRSNATI
AIVGAGITGLTTALLLDSVGMHNWELVEASERVGGRFRTKFVGRTKEWAEMGPMRLPWRVTYKSDGSTHEYSEHA
MVFQLADWLNELNANKPEDKIDFIPWIQHHANEGIARGTARHADGRVPTRGEIARDPSLGRMPPLKTAEYNETRK
RVNDFLMNEQTLRDIQRDPWRAHRAAMDAGLDDWSLQALLRHVLGVDADVADAIWTASDYDVLWDEMVHNSNLGL
DGGPGALGETQWLCVDGGFDRLSQAFVPHVRNRLKLGRKIKQVESIESQAARQQTRLTWCADAAPESGGSGTGRR
CGAKVYDYTMMTVPFTMTRLMELPRFSSILTRAMSEAGLRFKSACKVALLFRQRFWERGPRPIYGGYSMPASLAV
GALYYPSYGTNSSTPRPGLITHYRGGDWSDRFVSMTAEQHAQMALDAVVDLHGQEARRLYTGDYERLCWLQDEHA
ATAWCRPDVMQHRLYIPAYHRTEKNMIFMGEHTAPTHAWISSSLHSAVRGVVQLLLELGMPDEAKEVNGRWMGRW
IGMHQPVRMKTIYEMQRGR*
Coding >OphauB2|6459
ATGGCTTCAATTTGGAACCTGCTGGTTGGCGCACTGCTGTGCCTAGCAGGAAGTGTGCTGGGAAATGTGGTCGAG
AATCAGAATGGCCTTTATGAAGGAAACCAGCAGGGAAGAAATAAGCAGCAACATCCACTTCTCGAAGACTTTGAT
GCCCTGGGCGCATGGTTTGATCAAGTAGACAGCATCAAGGCCACAACGGCGCCACGCCGGTCCAACGCCACCATT
GCCATTGTCGGAGCCGGCATCACGGGCCTCACAACGGCGCTGCTGCTTGACAGCGTGGGCATGCACAACTGGGAG
CTGGTGGAAGCGTCGGAGCGGGTGGGAGGGCGGTTCCGGACAAAGTTTGTTGGCAGGACCAAGGAATGGGCAGAA
ATGGGACCGATGCGATTGCCGTGGCGCGTGACTTACAAGTCTGATGGATCTACGCACGAGTACTCGGAACATGCC
ATGGTGTTTCAACTGGCCGACTGGCTCAACGAGCTCAACGCCAACAAGCCGGAGGACAAGATTGATTTCATCCCG
TGGATTCAGCACCACGCGAATGAAGGCATTGCGCGCGGCACGGCCAGGCATGCAGATGGGCGTGTGCCGACGCGT
GGAGAAATCGCGCGGGATCCAAGTCTAGGGAGGATGCCGCCGCTCAAGACGGCGGAATACAACGAGACGAGGAAG
CGAGTAAACGACTTTTTAATGAATGAGCAGACGCTGCGGGACATTCAACGGGACCCGTGGCGAGCTCATCGAGCA
GCCATGGATGCTGGGCTGGACGACTGGAGTCTGCAGGCGTTGCTGAGGCATGTGCTTGGAGTTGATGCCGATGTG
GCGGATGCTATATGGACGGCGTCTGACTATGACGTGCTGTGGGATGAAATGGTGCACAATTCCAATCTTGGGCTT
GACGGCGGGCCCGGGGCGCTGGGAGAGACGCAGTGGCTCTGTGTTGATGGCGGCTTTGACCGTCTGTCGCAGGCC
TTTGTGCCTCATGTGAGAAACCGGCTAAAGCTGGGGCGCAAAATCAAACAAGTCGAGAGCATCGAGTCCCAGGCG
GCCAGACAGCAGACTCGACTGACGTGGTGCGCCGACGCGGCTCCCGAGTCAGGGGGAAGCGGCACGGGCCGTAGG
TGCGGCGCCAAAGTCTACGACTACACCATGATGACGGTCCCCTTTACCATGACGCGGCTCATGGAGCTGCCCCGC
TTCTCCTCCATCCTGACGCGAGCCATGAGCGAAGCCGGCTTGCGCTTCAAGTCGGCTTGCAAAGTGGCCCTGCTC
TTCCGGCAGCGCTTCTGGGAACGCGGCCCTCGGCCCATCTATGGCGGCTACTCCATGCCGGCGAGCCTGGCCGTC
GGAGCGCTCTACTACCCCAGCTACGGCACCAACTCGTCAACGCCACGGCCCGGCCTCATTACGCACTACCGCGGG
GGCGACTGGAGCGACCGCTTCGTCAGCATGACGGCGGAGCAGCACGCGCAAATGGCGCTGGATGCCGTTGTGGAC
CTCCACGGCCAAGAGGCGCGGCGGCTGTACACGGGCGACTATGAGCGGCTGTGCTGGCTGCAAGACGAGCATGCG
GCGACGGCGTGGTGCCGGCCAGATGTGATGCAGCACCGGCTGTACATTCCGGCATACCACAGGACGGAGAAGAAT
ATGATTTTCATGGGCGAGCACACGGCGCCGACGCATGCTTGGATCAGCTCGTCGTTGCACTCGGCCGTGAGGGGA
GTGGTGCAGCTGCTGCTGGAGCTGGGCATGCCGGATGAGGCAAAGGAGGTGAATGGGCGGTGGATGGGTCGGTGG
ATAGGAATGCATCAGCCCGTGAGGATGAAGACGATTTACGAGATGCAGAGGGGCAGGTAG
Transcript >OphauB2|6459
ATGGCTTCAATTTGGAACCTGCTGGTTGGCGCACTGCTGTGCCTAGCAGGAAGTGTGCTGGGAAATGTGGTCGAG
AATCAGAATGGCCTTTATGAAGGAAACCAGCAGGGAAGAAATAAGCAGCAACATCCACTTCTCGAAGACTTTGAT
GCCCTGGGCGCATGGTTTGATCAAGTAGACAGCATCAAGGCCACAACGGCGCCACGCCGGTCCAACGCCACCATT
GCCATTGTCGGAGCCGGCATCACGGGCCTCACAACGGCGCTGCTGCTTGACAGCGTGGGCATGCACAACTGGGAG
CTGGTGGAAGCGTCGGAGCGGGTGGGAGGGCGGTTCCGGACAAAGTTTGTTGGCAGGACCAAGGAATGGGCAGAA
ATGGGACCGATGCGATTGCCGTGGCGCGTGACTTACAAGTCTGATGGATCTACGCACGAGTACTCGGAACATGCC
ATGGTGTTTCAACTGGCCGACTGGCTCAACGAGCTCAACGCCAACAAGCCGGAGGACAAGATTGATTTCATCCCG
TGGATTCAGCACCACGCGAATGAAGGCATTGCGCGCGGCACGGCCAGGCATGCAGATGGGCGTGTGCCGACGCGT
GGAGAAATCGCGCGGGATCCAAGTCTAGGGAGGATGCCGCCGCTCAAGACGGCGGAATACAACGAGACGAGGAAG
CGAGTAAACGACTTTTTAATGAATGAGCAGACGCTGCGGGACATTCAACGGGACCCGTGGCGAGCTCATCGAGCA
GCCATGGATGCTGGGCTGGACGACTGGAGTCTGCAGGCGTTGCTGAGGCATGTGCTTGGAGTTGATGCCGATGTG
GCGGATGCTATATGGACGGCGTCTGACTATGACGTGCTGTGGGATGAAATGGTGCACAATTCCAATCTTGGGCTT
GACGGCGGGCCCGGGGCGCTGGGAGAGACGCAGTGGCTCTGTGTTGATGGCGGCTTTGACCGTCTGTCGCAGGCC
TTTGTGCCTCATGTGAGAAACCGGCTAAAGCTGGGGCGCAAAATCAAACAAGTCGAGAGCATCGAGTCCCAGGCG
GCCAGACAGCAGACTCGACTGACGTGGTGCGCCGACGCGGCTCCCGAGTCAGGGGGAAGCGGCACGGGCCGTAGG
TGCGGCGCCAAAGTCTACGACTACACCATGATGACGGTCCCCTTTACCATGACGCGGCTCATGGAGCTGCCCCGC
TTCTCCTCCATCCTGACGCGAGCCATGAGCGAAGCCGGCTTGCGCTTCAAGTCGGCTTGCAAAGTGGCCCTGCTC
TTCCGGCAGCGCTTCTGGGAACGCGGCCCTCGGCCCATCTATGGCGGCTACTCCATGCCGGCGAGCCTGGCCGTC
GGAGCGCTCTACTACCCCAGCTACGGCACCAACTCGTCAACGCCACGGCCCGGCCTCATTACGCACTACCGCGGG
GGCGACTGGAGCGACCGCTTCGTCAGCATGACGGCGGAGCAGCACGCGCAAATGGCGCTGGATGCCGTTGTGGAC
CTCCACGGCCAAGAGGCGCGGCGGCTGTACACGGGCGACTATGAGCGGCTGTGCTGGCTGCAAGACGAGCATGCG
GCGACGGCGTGGTGCCGGCCAGATGTGATGCAGCACCGGCTGTACATTCCGGCATACCACAGGACGGAGAAGAAT
ATGATTTTCATGGGCGAGCACACGGCGCCGACGCATGCTTGGATCAGCTCGTCGTTGCACTCGGCCGTGAGGGGA
GTGGTGCAGCTGCTGCTGGAGCTGGGCATGCCGGATGAGGCAAAGGAGGTGAATGGGCGGTGGATGGGTCGGTGG
ATAGGAATGCATCAGCCCGTGAGGATGAAGACGATTTACGAGATGCAGAGGGGCAGGTAG
Gene >OphauB2|6459
ATGGCTTCAATTTGGAACCTGCTGGTTGGCGCACTGCTGTGCCTAGCAGGAAGTGTGCTGGGAAATGTGGTCGAG
AATCAGAATGGCCTTTATGAAGGAAACCAGCAGGGAAGAAATAAGCAGCAACATCCACTTCTCGAAGACTTTGAT
GCCCTGGGCGCATGGTTTGATCAAGTAGACAGCATCAAGGCCACAACGGCGCCACGCCGGTCCAACGCCACCATT
GCCATTGTCGGAGCCGGCATCACGGGCCTCACAACGGCGCTGCTGCTTGACAGCGTGGGCATGCACAACTGGGAG
CTGGTGGAAGCGTCGGAGCGGGTGGGAGGGCGGTTCCGGACAAAGTTTGTTGGCAGGACCAAGGAATGGGCAGAA
ATGGGACCGATGCGATTGCCGTGGCGCGTGACTTACAAGTCTGATGGATCTACGCACGAGTACTCGGAACATGCC
ATGGTGTTTCAACTGGCCGACTGGCTCAACGAGCTCAACGCCAACAAGCCGGAGGACAAGATTGATTTCATCCCG
TGGATTCAGCACCACGCGAATGAAGGCATTGCGCGCGGCACGGCCAGGCATGCAGATGGGCGTGTGCCGACGCGT
GGAGAAATCGCGCGGGATCCAAGTCTAGGGAGGATGCCGCCGCTCAAGACGGCGGAATACAACGAGACGAGGAAG
CGAGTAAACGACTTTTTAATGAATGAGCAGACGCTGCGGGACATTCAACGGGACCCGTGGCGAGCTCATCGAGCA
GCCATGGATGCTGGGCTGGACGACTGGAGTCTGCAGGCGTTGCTGAGGCATGTGCTTGGAGTTGATGCCGATGTG
GCGGATGCTATATGGACGGCGTCTGACTATGACGTGCTGTGGGATGAAATGGTGCACAATTCCAATCTTGGGCTT
GACGGCGGGCCCGGGGCGCTGGGAGAGACGCAGTGGCTCTGTGTTGATGGCGGCTTTGACCGTCTGTCGCAGGCC
TTTGTGCCTCATGTGAGAAACCGGCTAAAGCTGGGGCGCAAAATCAAACAAGTCGAGAGCATCGAGTCCCAGGCG
GCCAGACAGCAGACTCGACTGACGTGGTGCGCCGACGCGGCTCCCGAGTCAGGGGGAAGCGGCACGGGCCGTAGG
TGCGGCGCCAAAGTCTACGACTACACCATGATGACGGTCCCCTTTACCATGACGCGGCTCATGGAGCTGCCCCGC
TTCTCCTCCATCCTGACGCGAGCCATGAGCGAAGCCGGCTTGCGCTTCAAGTCGGCTTGCAAAGTGGCCCTGCTC
TTCCGGCAGCGCTTCTGGGAACGCGGCCCTCGGCCCATCTATGGCGGCTACTCCATGCCGGCGAGCCTGGCCGTC
GGAGCGCTCTACTACCCCAGCTACGGCACCAACTCGTCAACGCCACGGCCCGGCCTCATTACGCACTACCGCGGG
GGCGACTGGAGCGACCGCTTCGTCAGCATGACGGCGGAGCAGCACGCGCAAATGGCGCTGGATGCCGTTGTGGAC
CTCCACGGCCAAGAGGCGCGGCGGCTGTACACGGGCGACTATGAGCGGCTGTGCTGGCTGCAAGACGAGCATGCG
GCGACGGCGTGGTGCCGGCCAGATGTGATGCAGCACCGGCTGTACATTCCGGCATACCACAGGACGGAGAAGAAT
ATGATTTTCATGGGCGAGCACACGGCGCCGACGCATGCTTGGATCAGCTCGTCGTTGCACTCGGCCGTGAGGGGA
GTGGTGCAGCTGCTGCTGGAGCTGGGCATGCCGGATGAGGCAAAGGAGGTGAATGGGCGGTGGATGGGTCGGTGG
ATAGGAATGCATCAGCCCGTGAGGATGAAGACGATTTACGAGATGCAGAGGGGCAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail