Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6448
Gene name
LocationContig_6:38617..40218
Strand+
Gene length (bp)1601
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04820 Trp_halogenase Tryptophan halogenase 6.2E-13 9 83
PF04820 Trp_halogenase Tryptophan halogenase 3.8E-12 98 365
PF01494 FAD_binding_3 FAD binding domain 3.2E-11 6 365
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.3E-04 11 38

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0VZ69|THAL_CHOCO Tryptophan 2-halogenase OS=Chondromyces crocatus GN=cmdE PE=4 SV=1 1 381 6.0E-65

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0071949 FAD binding Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup339
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1109
Ophiocordyceps australis 1348a (Ghana) OphauG2|1662
Ophiocordyceps australis map64 (Brazil) OphauB2|588
Ophiocordyceps australis map64 (Brazil) OphauB2|6448 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06233
Ophiocordyceps camponoti-rufipedis Ophun1|1945
Ophiocordyceps camponoti-rufipedis Ophun1|4166
Ophiocordyceps kimflemingae Ophio5|2110
Ophiocordyceps subramaniannii Hirsu2|4346
Ophiocordyceps subramaniannii Hirsu2|7114

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6448
MDVPQRCTVLVIGGGPAGSYPAAALAREGIDVVVLEADQFPRYHIGESTLPSLRQFFKFIDFYDAFNAHGFFHKA
CNYHAWLNRCLYTDFLAAGGPNGYAWNLIRSESDELLLKHAETSGAQVFQTTRVEAIQFAPSTATALPLDSHAAI
SSADRPISATWSGKDSTTGNISFEYLIDASGRHGILSTKYLKNRKFNDNFKNIANWGYWSGCEMYGRGTHMHGAP
YFEALSDASGWCWFMPLHDGTCSVGIVQSQKLAMEQKRQLGNPSTCDFYKQALQLASRTKRLLCSASLVTSVKSA
SDWSYTASTYHLPYARIAGDAGCFIDPLFSSGYHLAITTGLSAALTIAASLRGEHDEQTAGSWHSKKTLESYTRF
YLAVGSAAKQIRGQDEPVLLDENNEGFQRAFDILRPSKPRRRAWIPARCISTLPSFIHIYPET*
Coding >OphauB2|6448
ATGGACGTGCCGCAACGATGCACCGTGCTCGTCATTGGAGGAGGGCCCGCGGGGTCGTACCCGGCTGCGGCGCTG
GCGCGTGAGGGCATTGACGTGGTGGTGCTAGAGGCAGACCAGTTTCCTAGATACCACATTGGAGAGAGCACGCTT
CCGTCCCTGCGTCAATTCTTCAAGTTTATAGACTTTTACGATGCCTTTAATGCTCATGGCTTCTTTCACAAGGCA
TGCAACTACCATGCCTGGCTAAATCGATGCCTTTACACGGATTTCCTTGCCGCAGGCGGTCCCAACGGCTATGCC
TGGAACCTGATTCGATCCGAGTCTGACGAGTTGCTGCTGAAGCATGCGGAAACCAGCGGCGCCCAAGTCTTTCAA
ACAACAAGAGTCGAAGCTATTCAATTCGCGCCAAGCACTGCCACGGCTCTGCCACTGGATAGCCACGCAGCCATA
TCCAGCGCTGACCGTCCCATATCAGCGACCTGGTCCGGCAAAGACAGCACCACGGGTAATATTTCATTCGAGTAC
CTCATTGACGCCAGCGGCAGACACGGCATCCTGAGCACAAAGTATCTCAAAAATCGAAAATTCAACGACAACTTT
AAGAATATTGCAAACTGGGGCTACTGGTCTGGCTGTGAAATGTACGGCCGTGGCACACACATGCACGGCGCGCCC
TACTTTGAAGCCCTCTCAGATGCAAGTGGCTGGTGCTGGTTCATGCCTTTACACGACGGCACCTGTTCAGTCGGC
ATAGTGCAGAGCCAGAAACTCGCCATGGAGCAAAAACGCCAGCTTGGAAACCCATCGACCTGCGACTTTTACAAA
CAAGCCCTCCAGCTCGCCTCCCGAACCAAGAGGCTCCTATGTAGCGCATCTCTTGTAACCAGCGTCAAATCAGCC
TCGGACTGGTCCTACACCGCATCGACATACCACTTGCCCTATGCGCGCATTGCCGGAGACGCAGGCTGCTTCATC
GACCCCCTCTTCTCATCCGGCTACCACTTGGCCATTACAACGGGCCTCTCGGCGGCCCTTACTATAGCCGCGTCG
CTGCGTGGCGAGCACGACGAACAGACGGCCGGGTCGTGGCATTCGAAAAAGACGCTCGAGAGCTATACCCGCTTC
TACCTCGCCGTCGGCAGTGCGGCAAAGCAGATTCGCGGGCAAGACGAGCCGGTGCTGTTGGATGAGAACAACGAG
GGCTTTCAGAGAGCCTTTGACATTCTCAGACCGAGTAAGCCGCGGCGGCGCGCATGGATTCCAGCACGTTGTATT
TCCACATTGCCAAGCTTCATCCACATCTATCCCGAGACGTAA
Transcript >OphauB2|6448
ATGGACGTGCCGCAACGATGCACCGTGCTCGTCATTGGAGGAGGGCCCGCGGGGTCGTACCCGGCTGCGGCGCTG
GCGCGTGAGGGCATTGACGTGGTGGTGCTAGAGGCAGACCAGTTTCCTAGATACCACATTGGAGAGAGCACGCTT
CCGTCCCTGCGTCAATTCTTCAAGTTTATAGACTTTTACGATGCCTTTAATGCTCATGGCTTCTTTCACAAGGCA
TGCAACTACCATGCCTGGCTAAATCGATGCCTTTACACGGATTTCCTTGCCGCAGGCGGTCCCAACGGCTATGCC
TGGAACCTGATTCGATCCGAGTCTGACGAGTTGCTGCTGAAGCATGCGGAAACCAGCGGCGCCCAAGTCTTTCAA
ACAACAAGAGTCGAAGCTATTCAATTCGCGCCAAGCACTGCCACGGCTCTGCCACTGGATAGCCACGCAGCCATA
TCCAGCGCTGACCGTCCCATATCAGCGACCTGGTCCGGCAAAGACAGCACCACGGGTAATATTTCATTCGAGTAC
CTCATTGACGCCAGCGGCAGACACGGCATCCTGAGCACAAAGTATCTCAAAAATCGAAAATTCAACGACAACTTT
AAGAATATTGCAAACTGGGGCTACTGGTCTGGCTGTGAAATGTACGGCCGTGGCACACACATGCACGGCGCGCCC
TACTTTGAAGCCCTCTCAGATGCAAGTGGCTGGTGCTGGTTCATGCCTTTACACGACGGCACCTGTTCAGTCGGC
ATAGTGCAGAGCCAGAAACTCGCCATGGAGCAAAAACGCCAGCTTGGAAACCCATCGACCTGCGACTTTTACAAA
CAAGCCCTCCAGCTCGCCTCCCGAACCAAGAGGCTCCTATGTAGCGCATCTCTTGTAACCAGCGTCAAATCAGCC
TCGGACTGGTCCTACACCGCATCGACATACCACTTGCCCTATGCGCGCATTGCCGGAGACGCAGGCTGCTTCATC
GACCCCCTCTTCTCATCCGGCTACCACTTGGCCATTACAACGGGCCTCTCGGCGGCCCTTACTATAGCCGCGTCG
CTGCGTGGCGAGCACGACGAACAGACGGCCGGGTCGTGGCATTCGAAAAAGACGCTCGAGAGCTATACCCGCTTC
TACCTCGCCGTCGGCAGTGCGGCAAAGCAGATTCGCGGGCAAGACGAGCCGGTGCTGTTGGATGAGAACAACGAG
GGCTTTCAGAGAGCCTTTGACATTCTCAGACCGAGTAAGCCGCGGCGGCGCGCATGGATTCCAGCACGTTGTATT
TCCACATTGCCAAGCTTCATCCACATCTATCCCGAGACGTAA
Gene >OphauB2|6448
ATGGACGTGCCGCAACGATGCACCGTGCTCGTCATTGGAGGAGGGCCCGCGGGGTCGTACCCGGCTGCGGCGCTG
GCGCGTGAGGGCATTGACGTGGTGGTGCTAGAGGCAGACCAGTTTCCTAGGTTTTCCACGCCCAGTTTTGATTCA
TCTTATCAATCCATGCATCTTTGCTGCCCTGTCTTTACTGAGGATGCTAATGAGATTATAGATACCACATTGGAG
AGAGCACGCTTCCGTCCCTGCGTCAATTCTTCAAGTTTATAGACTTTTACGATGCCTTTAATGCTCATGGCTTCT
TTCACAAGGCATGCAACTACCATGCCTGGCTAAATCGATGCCTTTGTTTTTAAAACATGGAATTAACAGTCTCTA
GAACGGAGCTGTGTTTCGGCTAAACCAATCCAAGCCCGACGCATGCAAGTCTACGGCGCTGCTCCATGCCAGAAT
AAAAAAAGACTGACTCCTTGCCTAGACACGGATTTCCTTGCCGCAGGCGGTCCCAACGGCTATGCCTGGAACCTG
ATTCGATCCGAGTCTGACGAGTTGCTGCTGAAGCATGCGGAAACCAGCGGCGCCCAAGTCTTTCAAACAACAAGA
GTCGAAGCTATTCAATTCGCGCCAAGCACTGCCACGGCTCTGCCACTGGATAGCCACGCAGCCATATCCAGCGCT
GACCGTCCCATATCAGCGACCTGGTCCGGCAAAGACAGCACCACGGGTAATATTTCATTCGAGTACCTCATTGAC
GCCAGCGGCAGACACGGCATCCTGAGCACAAAGTATCTCAAAAATCGAAAATTCAACGACAACTTTAAGAATATT
GCAAACTGGGGCTACTGGTCTGGCTGTGAAATGTACGGCCGTGGCACACACATGCACGGCGCGCCCTACTTTGAA
GCCCTCTCAGGTATCCAGCCTCTCGCAGTCCAAAGCAAGCACCATCTTGTCGACCTCATGACTGACTCGCAGCAC
TAGATGCAAGTGGCTGGTGCTGGTTCATGCCTTTACACGACGGCACCTGTTCAGTCGGCATAGTGCAGAGCCAGA
AACTCGCCATGGAGCAAAAACGCCAGCTTGGAAACCCATCGACCTGCGACTTTTACAAACAAGCCCTCCAGCTCG
CCTCCCGAACCAAGAGGCTCCTATGTAGCGCATCTCTTGTAACCAGCGTCAAATCAGCCTCGGACTGGTCCTACA
CCGCATCGACATACCACTTGCCCTATGCGCGCATTGCCGGAGACGCAGGCTGCTTCATCGACCCCCTCTTCTCAT
CCGGCTACCACTTGGCCATTACAACGGGCCTCTCGGCGGCCCTTACTATAGCCGCGTCGCTGCGTGGCGAGCACG
ACGAACAGACGGCCGGGTCGTGGCATTCGAAAAAGACGCTCGAGAGCTATACCCGCTTCTACCTCGCCGTCGGCA
GTGCGGCAAAGCAGATTCGCGGGCAAGACGAGCCGGTGCTGTTGGATGAGAACAACGAGGGCTTTCAGAGAGCCT
TTGACATTCTCAGACCGAGTAAGCCGCGGCGGCGCGCATGGATTCCAGCACGTTGTATTTCCACATTGCCAAGCT
TCATCCACATCTATCCCGAGACGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail