Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6447
Gene name
LocationContig_6:36305..38152
Strand+
Gene length (bp)1847
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 3.0E-32 3 408

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43029|FAP1_SCHPO L-pipecolate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap1 PE=1 SV=1 1 442 4.0E-32
sp|Q9UTM9|FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap2 PE=1 SV=1 1 428 5.0E-24
sp|Q9SJA7|SOX_ARATH Probable sarcosine oxidase OS=Arabidopsis thaliana GN=At2g24580 PE=2 SV=1 1 440 1.0E-10
sp|Q29RU9|SOX_BOVIN Peroxisomal sarcosine oxidase OS=Bos taurus GN=PIPOX PE=2 SV=2 1 426 7.0E-10
sp|Q9P0Z9|SOX_HUMAN Peroxisomal sarcosine oxidase OS=Homo sapiens GN=PIPOX PE=1 SV=2 1 403 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43029|FAP1_SCHPO L-pipecolate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap1 PE=1 SV=1 1 442 4.0E-32
sp|Q9UTM9|FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap2 PE=1 SV=1 1 428 5.0E-24
sp|Q9SJA7|SOX_ARATH Probable sarcosine oxidase OS=Arabidopsis thaliana GN=At2g24580 PE=2 SV=1 1 440 1.0E-10
sp|Q29RU9|SOX_BOVIN Peroxisomal sarcosine oxidase OS=Bos taurus GN=PIPOX PE=2 SV=2 1 426 7.0E-10
sp|Q9P0Z9|SOX_HUMAN Peroxisomal sarcosine oxidase OS=Homo sapiens GN=PIPOX PE=1 SV=2 1 403 1.0E-09
sp|P79371|SOX_RABIT Peroxisomal sarcosine oxidase OS=Oryctolagus cuniculus GN=PIPOX PE=1 SV=1 1 403 5.0E-09
sp|Q9D826|SOX_MOUSE Peroxisomal sarcosine oxidase OS=Mus musculus GN=Pipox PE=1 SV=1 1 403 8.0E-09
sp|P40854|MSOX_STRSB Monomeric sarcosine oxidase OS=Streptomyces sp. (strain KB210-8SY) GN=soxA PE=1 SV=2 154 415 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6447
MAAGVFGISLALELQRRGHRVTVFDQYRYDETAYKLTSTEPEQAASVDSNKIFRASYGKKMEYQRLALESRSAWL
ALNQTSHPPLFEPCGMLRVQPSDTLSPLELETLASLARDGLGSLQFIASDPQDVQRAASQGWAAKLLGFRDAQGK
ALEAVLDATAGFTRCAEACAYFQRLAAAEGVVFCLGCREGCFDSLVTDGMRARGIVTRDGRKHFADTVVIAAGSS
STQILPQLSYHLESSAGSIATFKIERSNTALWNKYAPASFPVVTWKSLARTDGKDVGSIYVLPRTEDGLLKIGYR
GIKFTNFQPAPQSASFSQQGMWSIPLKSQQLPAEAVDAIKTFVSMFLPEFDGVPFYSTRLCWYTDTLDNSFLIDH
VPGYQDQSLFVCTGGSGHGAKFLPVLGKHAADIFENGSKSTSPMRELWRWRDDVPRRNGLDEGPDGPRNLAKRDS
HLVSPGRKE*
Coding >OphauB2|6447
ATGGCAGCCGGCGTCTTTGGCATCTCGCTGGCTCTGGAGCTGCAGAGACGAGGCCACCGCGTCACCGTCTTTGAC
CAGTACCGCTATGATGAGACGGCATATAAACTCACAAGCACTGAGCCCGAGCAGGCGGCCTCTGTCGACTCCAAC
AAGATTTTTCGCGCATCCTATGGCAAGAAGATGGAGTACCAGCGCCTCGCCCTCGAAAGCCGCTCCGCCTGGCTC
GCCCTCAACCAAACCTCCCACCCCCCCCTTTTTGAACCCTGCGGCATGCTACGCGTACAGCCGTCAGACACGCTC
AGCCCGCTCGAACTCGAAACACTAGCCAGCCTGGCGCGCGACGGCCTCGGCAGCTTGCAATTCATTGCCAGCGAC
CCCCAAGACGTGCAGCGCGCCGCAAGCCAGGGCTGGGCGGCAAAGCTGCTCGGGTTTCGAGACGCACAGGGAAAA
GCCCTCGAGGCGGTGCTCGACGCCACGGCGGGATTCACGCGCTGCGCAGAGGCGTGTGCGTATTTTCAGCGGCTG
GCGGCGGCAGAAGGGGTTGTTTTTTGCCTTGGTTGTCGAGAGGGCTGTTTTGACTCGCTCGTTACTGACGGCATG
AGAGCAAGGGGCATCGTAACAAGGGATGGCAGGAAGCACTTTGCAGACACTGTTGTTATTGCCGCCGGATCCTCT
TCCACTCAGATACTCCCCCAGCTATCCTATCACCTCGAGTCATCGGCCGGTAGCATCGCCACCTTTAAGATTGAG
CGCAGCAACACGGCCCTCTGGAACAAGTATGCGCCTGCAAGCTTTCCCGTCGTGACGTGGAAGAGTCTTGCTCGC
ACAGACGGCAAGGACGTGGGCAGCATCTACGTCCTCCCGCGCACAGAGGACGGCCTGCTCAAGATTGGCTACCGC
GGCATCAAGTTTACCAATTTCCAACCTGCGCCCCAGAGTGCCTCCTTTAGCCAGCAGGGCATGTGGTCCATTCCT
CTCAAGTCTCAGCAACTGCCAGCCGAGGCAGTCGATGCCATCAAGACATTTGTCTCCATGTTTCTACCAGAGTTT
GACGGTGTGCCGTTTTATTCAACAAGGCTGTGCTGGTATACGGATACGCTCGACAATTCCTTTCTAATTGATCAC
GTCCCCGGCTATCAAGACCAGTCCCTCTTTGTCTGCACCGGCGGAAGCGGCCACGGCGCCAAGTTTTTACCCGTA
CTAGGCAAGCACGCAGCCGACATTTTTGAAAATGGCAGCAAGAGCACGTCACCAATGCGAGAGCTCTGGCGCTGG
AGAGATGATGTCCCTCGGCGAAACGGGCTGGATGAAGGACCAGACGGGCCGCGAAACTTGGCCAAGCGAGATTCA
CATCTTGTTTCTCCTGGCCGCAAAGAATGA
Transcript >OphauB2|6447
ATGGCAGCCGGCGTCTTTGGCATCTCGCTGGCTCTGGAGCTGCAGAGACGAGGCCACCGCGTCACCGTCTTTGAC
CAGTACCGCTATGATGAGACGGCATATAAACTCACAAGCACTGAGCCCGAGCAGGCGGCCTCTGTCGACTCCAAC
AAGATTTTTCGCGCATCCTATGGCAAGAAGATGGAGTACCAGCGCCTCGCCCTCGAAAGCCGCTCCGCCTGGCTC
GCCCTCAACCAAACCTCCCACCCCCCCCTTTTTGAACCCTGCGGCATGCTACGCGTACAGCCGTCAGACACGCTC
AGCCCGCTCGAACTCGAAACACTAGCCAGCCTGGCGCGCGACGGCCTCGGCAGCTTGCAATTCATTGCCAGCGAC
CCCCAAGACGTGCAGCGCGCCGCAAGCCAGGGCTGGGCGGCAAAGCTGCTCGGGTTTCGAGACGCACAGGGAAAA
GCCCTCGAGGCGGTGCTCGACGCCACGGCGGGATTCACGCGCTGCGCAGAGGCGTGTGCGTATTTTCAGCGGCTG
GCGGCGGCAGAAGGGGTTGTTTTTTGCCTTGGTTGTCGAGAGGGCTGTTTTGACTCGCTCGTTACTGACGGCATG
AGAGCAAGGGGCATCGTAACAAGGGATGGCAGGAAGCACTTTGCAGACACTGTTGTTATTGCCGCCGGATCCTCT
TCCACTCAGATACTCCCCCAGCTATCCTATCACCTCGAGTCATCGGCCGGTAGCATCGCCACCTTTAAGATTGAG
CGCAGCAACACGGCCCTCTGGAACAAGTATGCGCCTGCAAGCTTTCCCGTCGTGACGTGGAAGAGTCTTGCTCGC
ACAGACGGCAAGGACGTGGGCAGCATCTACGTCCTCCCGCGCACAGAGGACGGCCTGCTCAAGATTGGCTACCGC
GGCATCAAGTTTACCAATTTCCAACCTGCGCCCCAGAGTGCCTCCTTTAGCCAGCAGGGCATGTGGTCCATTCCT
CTCAAGTCTCAGCAACTGCCAGCCGAGGCAGTCGATGCCATCAAGACATTTGTCTCCATGTTTCTACCAGAGTTT
GACGGTGTGCCGTTTTATTCAACAAGGCTGTGCTGGTATACGGATACGCTCGACAATTCCTTTCTAATTGATCAC
GTCCCCGGCTATCAAGACCAGTCCCTCTTTGTCTGCACCGGCGGAAGCGGCCACGGCGCCAAGTTTTTACCCGTA
CTAGGCAAGCACGCAGCCGACATTTTTGAAAATGGCAGCAAGAGCACGTCACCAATGCGAGAGCTCTGGCGCTGG
AGAGATGATGTCCCTCGGCGAAACGGGCTGGATGAAGGACCAGACGGGCCGCGAAACTTGGCCAAGCGAGATTCA
CATCTTGTTTCTCCTGGCCGCAAAGAATGA
Gene >OphauB2|6447
ATGGCAGCCGGCGTCTTTGGCATCTCGCTGGCTCTGGAGCTGCAGAGACGAGGTATGCCGCAGCGTGCAATGTGC
ATGGCGATACAAGCTCCATGGCTACTGATTGTCGTCTAGGCCACCGCGTCACCGTCTTTGACCAGTACCGCTATG
ATGAGACGGCATATAAACTCACAAGCACTGAGCCCGAGCAGGCGGCCTCTGTCGACTCCAACAAGATTGTAAGAT
GCTCGACATGTTCAAAAAAAATACAAAAAAAAGAAAAAGAAAAAAGGAACAGAAATATAAACCTGCGCTGACGAC
GCATAAGTTTCGCGCATCCTATGGCAAGAAGATGGAGTACCAGCGCCTCGCCCTCGAAAGCCGCTCCGCCTGGCT
CGCCCTCAACCAAACCTCCCACCCCCCCCTTTTTGAACCCTGCGGCATGCTACGCGTACAGCCGTCAGACACGCT
CAGCCCGCTCGAACTCGAAACACTAGCCAGCCTGGCGCGCGACGGCCTCGGCAGCTTGCAATTCATTGCCAGCGA
CCCCCAAGACGTGCAGCGCGCCGCAAGCCAGGGCTGGGCGGCAAAGCTGCTCGGGTTTCGAGACGCACAGGGAAA
AGCCCTCGAGGCGGTGCTCGACGCCACGGCGGGATTCACGCGCTGCGCAGAGGCGTGTGCGTATTTTCAGCGGCT
GGCGGCGGCAGAAGGGGTTGTTTTTTGCCTTGGTTGTCGAGAGGGCTGTTTTGACTCGCTCGTTACTGACGGCAT
GAGAGCAAGGGGCATCGTAACAAGGGATGGCAGGAAGCACTTTGCAGACACTGTTGTTATTGCCGGTAAGTCGGC
ACTCTTGGTCGTCGGCTTGGTCTTGCGCTTCAACTATACCCAGCCGGATCCTCTTCCACTCAGATACTCCCCCAG
CTATCCTATCACCTCGAGTCATCGGCCGGTAGCATCGCCACCTTTAAGATTGAGCGCAGCAACACGGCCCTCTGG
AACAAGTATGCGCCTGCAAGCTTTCCCGTCGTGACGTGGAAGAGTCTTGCTCGCACAGACGGCAAGGACGTGGGC
AGCATCTACGTCCTCCCGCGCACAGAGGACGGCCTGCTCAAGATTGGCTACCGCGGCATCAAGGTGTGTGCTTTT
TCTTTTCTCGTCTCTCTTGGTCTTGCAGAGGGCTTGGCCGAGTTTGCTTACCCGTGTCTAGTTTACCAATTTCCA
ACCTGCGCCCCAGAGTGCCTCCTTTAGCCAGCAGGGCATGTGGTCCATTCCTCTCAAGTCTCAGCAACTGCCAGC
CGAGGCAGTCGATGCCATCAAGACATTTGTCTCCATGTTTCTACCAGAGTTTGACGGTGTGCCGTTTTATTCAAC
AAGGCTGTGCTGGTATACGGATACGCTCGACAATTCCTTTCTAGTAAGATGCCTCTTTCCCCGCCTCCCTTGATT
TGTGTCAGGATCCCTTTCTTACGCCAGCTCTGGCTTGTCTCCATTTCTTTGCACTCTATACTCCAAAGGCGAGCA
ACGGCGTAACAATGTTGATTATAGATTGATCACGTCCCCGGCTATCAAGACCAGTCCCTCTTTGTCTGCACCGGC
GGAAGCGGCCACGGCGCCAAGTTTTTACCCGTACTAGGCAAGGTAAAGACGCGTCCCCATTTTTTTTCAAACATG
CCGTCAGGGACTAACAGTGTGAGCAGCACGCAGCCGACATTTTTGAAAATGGCAGCAAGAGCACGTCACCAATGC
GAGAGCTCTGGCGCTGGAGAGATGATGTCCCTCGGCGAAACGGGCTGGATGAAGGACCAGACGGGCCGCGAAACT
TGGCCAAGCGAGATTCACATCTTGTTTCTCCTGGCCGCAAAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail