Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6444
Gene name
LocationContig_6:33897..34384
Strand-
Gene length (bp)487
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 6 136 2.0E-09
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 1 136 4.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 55 77 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6444
MFFNELPNNTSQQLPLIIVGFGFTPAESALFNIIKPLWGQMLIFISAALLYSTDLGVGYTCALSYIPCFIGGIIM
VTAPWSNKVALVVGTQISTFKPSYLLGLSWAGTTTNGYTKKLCLMSTCVVAAAVANMISPE*
Coding >OphauB2|6444
ATGTTCTTCAACGAGCTTCCAAACAACACGTCGCAGCAGCTGCCCCTTATTATTGTCGGCTTCGGCTTTACGCCC
GCTGAGAGCGCCTTGTTCAACATCATCAAGCCACTGTGGGGCCAGATGCTCATTTTCATCTCGGCCGCGCTGCTA
TACAGCACAGACCTCGGAGTCGGCTACACCTGTGCTCTCTCCTACATTCCCTGCTTCATCGGCGGCATCATCATG
GTTACCGCCCCCTGGTCTAACAAGGTGGCCCTCGTTGTCGGCACTCAAATCTCAACTTTCAAGCCTTCCTACCTA
CTTGGCCTCTCATGGGCTGGCACGACAACAAATGGTTACACTAAAAAGTTGTGCCTCATGTCCACCTGTGTCGTT
GCCGCGGCCGTGGCAAACATGATTTCTCCAGAGTAG
Transcript >OphauB2|6444
ATGTTCTTCAACGAGCTTCCAAACAACACGTCGCAGCAGCTGCCCCTTATTATTGTCGGCTTCGGCTTTACGCCC
GCTGAGAGCGCCTTGTTCAACATCATCAAGCCACTGTGGGGCCAGATGCTCATTTTCATCTCGGCCGCGCTGCTA
TACAGCACAGACCTCGGAGTCGGCTACACCTGTGCTCTCTCCTACATTCCCTGCTTCATCGGCGGCATCATCATG
GTTACCGCCCCCTGGTCTAACAAGGTGGCCCTCGTTGTCGGCACTCAAATCTCAACTTTCAAGCCTTCCTACCTA
CTTGGCCTCTCATGGGCTGGCACGACAACAAATGGTTACACTAAAAAGTTGTGCCTCATGTCCACCTGTGTCGTT
GCCGCGGCCGTGGCAAACATGATTTCTCCAGAGTAG
Gene >OphauB2|6444
ATGTTCTTCAACGAGCTTCCAAACAACACGTCGCAGCAGCTGCCCCTTATTATTGTCGGCTTCGGCTTTACGCCC
GCTGAGAGCGCCTTGTTCAACATCATCAAGCCACTGTGGGGCCAGATGCTCATTTTCATCTCGGCCGCGCTGCTA
TACAGCACAGACCTCGGAGTCGGCTACACCTGTGCTCTCTCCTACATTCCCTGCTTCATCGGCGGCATCATCATG
GTAAGCCGGTTTTTTACCGTCAAGAGGAATAAATCTCGCCAATCTTTAACCAAGATGACCCTTGACGCCTTGTTA
GGTTACCGCCCCCTGGTCTAACAAGGTGGCCCTCGTTGTCGGCACTCAAATCTCAACTTTCAAGCCTTCCTACCT
ACTTGGCCTCTCATGGGCTGGCACGACAACAAATGGTTACACTAAAAAGTTGTGCCTCATGTCCACCTGTGTCGT
TGCCGCGGCCGTGGCAAACATGATTTCTCCAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail