Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6430
Gene name
LocationContig_6:318..1536
Strand-
Gene length (bp)1218
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 1.3E-14 130 208

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5A4E3|OCH1_CANAL Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OCH1 PE=3 SV=1 5 370 2.0E-98
sp|Q9UTR6|OCH1_SCHPO Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=och1 PE=1 SV=2 92 370 7.0E-76
sp|P31755|OCH1_YEAST Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCH1 PE=1 SV=1 89 376 2.0E-72
sp|P47124|HOC1_YEAST Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOC1 PE=1 SV=3 73 368 4.0E-69

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6430
MLNSRRAILAAACLLTIFFLISRTSHPSPTTWTAKKPSSKAAATEQEAAGVVDNGVAGISNSNSNSNNNNWPERK
PVAQKPMMDTSNMSLWDKLAYAYPYDIKVKFPAFIWQTWKTTPSDGNFPFRDQEASWSEQHPGFIHEVVTDNVAH
SLLRLFYASVPEVLEAYQALPLPVHKADFFRYLILFARGGIYSDIDTSALKSALEWIPADVSRDTVGLVVGIEAD
PDRPDWAQWYSRRIQFCQWTIQSKPGHPVLRDIIARITNDTLTMKHSGRMNVYDGKHVVDLTGPAIWTDTIMDYF
NDERFFDTAHSLGKIDWHNFTGMETSKRVGDVVVLPITSFSPGVEQMGAKDDDDPMAFVKHDFEGTWKPDSERHI
GGQQP*
Coding >OphauB2|6430
ATGCTCAACTCTCGCCGCGCCATTCTGGCGGCTGCGTGCTTGCTGACCATCTTCTTCCTCATTTCGCGCACCAGC
CATCCGTCGCCGACTACATGGACGGCCAAGAAGCCCAGCTCAAAGGCTGCTGCGACGGAGCAAGAAGCAGCAGGC
GTGGTTGACAATGGCGTGGCTGGCATCAGCAACAGCAACAGCAACAGCAACAACAACAACTGGCCCGAGAGGAAG
CCCGTGGCGCAGAAGCCCATGATGGACACGTCCAACATGTCGCTCTGGGACAAGCTGGCGTACGCATACCCCTAC
GACATCAAGGTCAAGTTTCCCGCCTTCATCTGGCAGACGTGGAAGACGACGCCCAGCGACGGCAATTTTCCCTTT
CGCGACCAAGAAGCCTCGTGGTCAGAACAGCACCCCGGCTTCATCCACGAGGTGGTAACCGACAATGTTGCCCAC
AGTCTGCTGCGCCTCTTTTACGCGTCGGTGCCCGAGGTGCTCGAGGCCTACCAAGCGCTGCCGCTGCCCGTCCAC
AAGGCCGACTTTTTCCGCTACCTGATTCTCTTTGCCCGCGGCGGCATCTACTCCGACATTGACACGTCTGCCCTC
AAGAGCGCGCTCGAGTGGATCCCGGCCGACGTTTCTCGCGACACGGTGGGCCTGGTGGTGGGCATCGAGGCCGAT
CCTGACCGCCCCGACTGGGCGCAGTGGTACAGCCGGCGCATCCAATTCTGCCAGTGGACCATTCAGAGCAAGCCG
GGCCATCCCGTCTTGCGCGACATTATTGCGCGCATCACAAACGACACGCTCACCATGAAGCACAGCGGCCGCATG
AACGTCTATGACGGCAAGCACGTGGTTGACTTGACGGGGCCTGCCATTTGGACCGACACCATTATGGACTACTTC
AACGACGAGCGCTTCTTTGACACGGCGCACAGCCTCGGCAAGATTGACTGGCACAACTTTACCGGCATGGAGACG
AGCAAGCGCGTGGGCGATGTCGTGGTGCTGCCCATTACCAGCTTCTCACCGGGCGTGGAGCAAATGGGGGCCAAG
GACGATGACGACCCCATGGCTTTTGTGAAGCATGACTTTGAGGGCACGTGGAAACCTGATAGCGAGAGACACATT
GGCGGGCAGCAGCCATAG
Transcript >OphauB2|6430
ATGCTCAACTCTCGCCGCGCCATTCTGGCGGCTGCGTGCTTGCTGACCATCTTCTTCCTCATTTCGCGCACCAGC
CATCCGTCGCCGACTACATGGACGGCCAAGAAGCCCAGCTCAAAGGCTGCTGCGACGGAGCAAGAAGCAGCAGGC
GTGGTTGACAATGGCGTGGCTGGCATCAGCAACAGCAACAGCAACAGCAACAACAACAACTGGCCCGAGAGGAAG
CCCGTGGCGCAGAAGCCCATGATGGACACGTCCAACATGTCGCTCTGGGACAAGCTGGCGTACGCATACCCCTAC
GACATCAAGGTCAAGTTTCCCGCCTTCATCTGGCAGACGTGGAAGACGACGCCCAGCGACGGCAATTTTCCCTTT
CGCGACCAAGAAGCCTCGTGGTCAGAACAGCACCCCGGCTTCATCCACGAGGTGGTAACCGACAATGTTGCCCAC
AGTCTGCTGCGCCTCTTTTACGCGTCGGTGCCCGAGGTGCTCGAGGCCTACCAAGCGCTGCCGCTGCCCGTCCAC
AAGGCCGACTTTTTCCGCTACCTGATTCTCTTTGCCCGCGGCGGCATCTACTCCGACATTGACACGTCTGCCCTC
AAGAGCGCGCTCGAGTGGATCCCGGCCGACGTTTCTCGCGACACGGTGGGCCTGGTGGTGGGCATCGAGGCCGAT
CCTGACCGCCCCGACTGGGCGCAGTGGTACAGCCGGCGCATCCAATTCTGCCAGTGGACCATTCAGAGCAAGCCG
GGCCATCCCGTCTTGCGCGACATTATTGCGCGCATCACAAACGACACGCTCACCATGAAGCACAGCGGCCGCATG
AACGTCTATGACGGCAAGCACGTGGTTGACTTGACGGGGCCTGCCATTTGGACCGACACCATTATGGACTACTTC
AACGACGAGCGCTTCTTTGACACGGCGCACAGCCTCGGCAAGATTGACTGGCACAACTTTACCGGCATGGAGACG
AGCAAGCGCGTGGGCGATGTCGTGGTGCTGCCCATTACCAGCTTCTCACCGGGCGTGGAGCAAATGGGGGCCAAG
GACGATGACGACCCCATGGCTTTTGTGAAGCATGACTTTGAGGGCACGTGGAAACCTGATAGCGAGAGACACATT
GGCGGGCAGCAGCCATAG
Gene >OphauB2|6430
ATGCTCAACTCTCGCCGCGCCATTCTGGCGGCTGCGTGCTTGCTGACCATCTTCTTCCTCATTTCGCGCACCAGC
CATCCGTCGCCGACTACATGGACGGCCAAGAAGCCCAGCTCAAAGGCTGCTGCGACGGAGCAAGAAGCAGCAGGC
GTGGTTGACAATGGCGTGGCTGGCATCAGCAACAGCAACAGCAACAGCAACAACAACAACTGGCCCGAGAGGAAG
CCCGTGGCGCAGAAGCCCATGATGGACACGTCCAACATGTCGCTCTGGGACAAGCTGGCGTACGCATACCCCTAC
GACATCAAGGTCAAGTTTCCCGCCTTCATCTGGCAGACGTGGAAGACGACGCCCAGCGACGGCAATTTTCCCTTT
CGCGACCAAGAAGCCTCGTGGTCAGAACAGCACCCCGGCTTCATCCACGAGGTGGTAACCGACAATGTTGCCCAC
AGTCTGCTGCGCCTCTTTTACGCGTCGGTGCCCGAGGTGCTCGAGGCCTACCAAGCGCTGCCGCTGCCCGTCCAC
AAGGCCGACTTTTTCCGCTACCTGATTCTCTTTGCCCGCGGCGGCATCTACTCCGACATTGACACGTCTGCCCTC
AAGAGCGCGCTCGAGTGGATCCCGGCCGACGTTTCTCGCGACACGGTGGGCCTGGTGGTGGGCATCGAGGCCGAT
CCTGACCGCCCCGACTGGGCGCAGTGGTACAGCCGGCGCATCCAATTCTGCCAGTGGACCATTCAGAGCAAGCCG
GGCCATCCCGTCTTGCGCGACATTATTGCGCGCATCACAAACGACACGCTCACCATGAAGCACAGCGGCCGCATG
AACGTCTATGACGGCAAGCACGTGGTTGACTTGACGGGGCCTGCCATTTGGACCGACACCATTATGGACTACTTC
AACGACGAGCGCTTCTTTGACACGGCGCACAGCCTCGGCAAGATTGACTGGCACAACTTTACCGGCATGGAGACG
AGCAAGCGCGTGGGCGATGTCGTGGTGCTGCCCATTACCAGCTTCTCACCGGGCGTGGAGCAAATGGGGGCCAAG
GACGATGACGACCCCATGGCTTTTGTGAAGCATGACTTTGAGGGTATGTGGATTCCAAGCTTTCTACTGCTCTCG
TCTCTCTCTTTAGTCAAGGGCGGCAACTAACCCGAGCATACAGGCACGTGGAAACCTGATAGCGAGAGACACATT
GGCGGGCAGCAGCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail