Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6429
Gene name
LocationContig_59:107496..111025
Strand+
Gene length (bp)3529
Transcript length (bp)3231
Coding sequence length (bp)3231
Protein length (aa) 1077

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.0E-40 720 1025
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.8E-23 721 930

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wee1 PE=1 SV=1 714 1048 7.0E-75
sp|P32944|SWE1_YEAST Mitosis inhibitor protein kinase SWE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWE1 PE=1 SV=1 625 1053 1.0E-62
sp|Q5AP97|SWE1_CANAL Mitosis inhibitor protein kinase SWE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWE1 PE=1 SV=1 656 955 3.0E-54
sp|P30290|MIK1_SCHPO Mitosis inhibitor protein kinase mik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mik1 PE=3 SV=1 709 1050 5.0E-46
sp|Q91618|PMYT1_XENLA Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1 699 948 3.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wee1 PE=1 SV=1 714 1048 7.0E-75
sp|P32944|SWE1_YEAST Mitosis inhibitor protein kinase SWE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWE1 PE=1 SV=1 625 1053 1.0E-62
sp|Q5AP97|SWE1_CANAL Mitosis inhibitor protein kinase SWE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWE1 PE=1 SV=1 656 955 3.0E-54
sp|P30290|MIK1_SCHPO Mitosis inhibitor protein kinase mik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mik1 PE=3 SV=1 709 1050 5.0E-46
sp|Q91618|PMYT1_XENLA Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1 699 948 3.0E-40
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 713 948 1.0E-36
sp|Q54F40|Y1133_DICDI Probable protein kinase DDB_G0291133 OS=Dictyostelium discoideum GN=DDB_G0291133 PE=3 SV=1 716 945 3.0E-36
sp|Q9NI63|PMYT1_DROME Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Drosophila melanogaster GN=Myt1 PE=1 SV=2 698 950 5.0E-36
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 710 948 2.0E-35
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 710 948 5.0E-35
sp|Q6Z829|WEE1_ORYSJ Wee1-like protein kinase OS=Oryza sativa subsp. japonica GN=WEE1 PE=3 SV=1 666 952 4.0E-33
sp|A4PES0|WEE2_PIG Wee1-like protein kinase 2 OS=Sus scrofa GN=WEE2 PE=1 SV=2 716 970 1.0E-32
sp|D2HHP1|WEE2_AILME Wee1-like protein kinase 2 OS=Ailuropoda melanoleuca GN=WEE2 PE=3 SV=1 712 973 1.0E-32
sp|E2RSS3|WEE2_CANLF Wee1-like protein kinase 2 OS=Canis lupus familiaris GN=WEE2 PE=3 SV=1 712 952 2.0E-31
sp|A4QNA8|WEE2_XENTR Wee1-like protein kinase 2 OS=Xenopus tropicalis GN=wee2 PE=2 SV=1 718 967 7.0E-31
sp|E1BTE1|WEE2_CHICK Wee1-like protein kinase 2 OS=Gallus gallus GN=WEE2 PE=3 SV=1 708 973 9.0E-31
sp|Q1LX51|WEE2_DANRE Wee1-like protein kinase 2 OS=Danio rerio GN=wee2 PE=2 SV=2 718 952 1.0E-30
sp|P47817|WEE2A_XENLA Wee1-like protein kinase 2-A OS=Xenopus laevis GN=wee2-a PE=1 SV=2 718 954 1.0E-29
sp|P0C1S8|WEE2_HUMAN Wee1-like protein kinase 2 OS=Homo sapiens GN=WEE2 PE=2 SV=2 712 952 2.0E-29
sp|O18209|PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans GN=wee-1.3 PE=1 SV=1 636 948 5.0E-29
sp|Q66JT0|WEE2_MOUSE Wee1-like protein kinase 2 OS=Mus musculus GN=Wee2 PE=1 SV=2 712 951 6.0E-29
sp|Q6DFE0|WEE2C_XENLA Wee1-like protein kinase 2-C OS=Xenopus laevis GN=wee2-c PE=2 SV=1 718 952 1.0E-28
sp|O57473|WEE2B_XENLA Wee1-like protein kinase 2-B OS=Xenopus laevis GN=wee2-b PE=1 SV=1 718 952 2.0E-28
sp|P47810|WEE1_MOUSE Wee1-like protein kinase OS=Mus musculus GN=Wee1 PE=1 SV=2 718 970 2.0E-28
sp|Q8AYK6|WEE1A_XENLA Wee1-like protein kinase 1-A OS=Xenopus laevis GN=wee1-a PE=2 SV=1 648 954 5.0E-28
sp|P30291|WEE1_HUMAN Wee1-like protein kinase OS=Homo sapiens GN=WEE1 PE=1 SV=2 718 970 6.0E-28
sp|Q626B1|PMY13_CAEBR Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis briggsae GN=wee-1.3 PE=3 SV=1 718 950 6.0E-28
sp|Q63802|WEE1_RAT Wee1-like protein kinase OS=Rattus norvegicus GN=Wee1 PE=1 SV=1 718 954 6.0E-28
sp|Q8QGV2|WEE1B_XENLA Wee1-like protein kinase 1-B OS=Xenopus laevis GN=wee1-b PE=1 SV=1 718 954 1.0E-27
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 774 973 1.0E-23
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 666 949 2.0E-23
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 700 928 2.0E-23
sp|Q8L4H0|WEE1_ARATH Wee1-like protein kinase OS=Arabidopsis thaliana GN=WEE1 PE=1 SV=1 718 952 2.0E-22
sp|P54350|WEE1_DROME Wee1-like protein kinase OS=Drosophila melanogaster GN=Wee1 PE=1 SV=2 704 955 2.0E-21
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 711 927 9.0E-21
sp|Q20085|PMY11_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.1 OS=Caenorhabditis elegans GN=wee-1.1 PE=2 SV=2 632 950 1.0E-19
sp|Q54ZN3|Y0004_DICDI Probable protein kinase DDB_G0277539 OS=Dictyostelium discoideum GN=DDB_G0277539 PE=3 SV=1 718 873 2.0E-19
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 722 954 3.0E-19
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 704 928 8.0E-19
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 774 929 1.0E-18
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 717 928 2.0E-18
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 627 931 2.0E-18
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 707 929 3.0E-18
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 718 927 4.0E-18
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 716 928 4.0E-18
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 718 930 5.0E-18
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 759 928 8.0E-18
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 782 973 1.0E-17
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 782 973 1.0E-17
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 718 928 1.0E-17
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 691 927 2.0E-17
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 718 928 2.0E-17
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 718 926 2.0E-17
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 716 928 2.0E-17
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 627 931 3.0E-17
sp|X5M5N0|WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans GN=wnk-1 PE=1 SV=1 711 928 3.0E-17
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 716 926 3.0E-17
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 718 926 3.0E-17
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 715 928 4.0E-17
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 745 928 4.0E-17
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 716 927 4.0E-17
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 686 927 4.0E-17
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 716 928 6.0E-17
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 716 929 8.0E-17
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 716 929 8.0E-17
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 744 928 9.0E-17
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 718 931 9.0E-17
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 718 927 1.0E-16
sp|Q0CLX3|ATG1_ASPTN Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg1 PE=3 SV=1 717 929 2.0E-16
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 784 927 2.0E-16
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 716 929 2.0E-16
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 717 951 2.0E-16
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 718 929 2.0E-16
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 718 926 2.0E-16
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 715 928 3.0E-16
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 680 927 3.0E-16
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 724 927 4.0E-16
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 782 951 4.0E-16
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 737 928 4.0E-16
sp|Q54QB1|ERK2_DICDI Extracellular signal-regulated kinase 2 OS=Dictyostelium discoideum GN=erkB PE=1 SV=1 705 927 4.0E-16
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 724 928 4.0E-16
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 716 923 4.0E-16
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 715 928 4.0E-16
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 715 928 4.0E-16
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 688 928 5.0E-16
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 782 923 5.0E-16
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 718 929 5.0E-16
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 711 928 5.0E-16
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 716 928 6.0E-16
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 716 928 6.0E-16
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 718 927 6.0E-16
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 715 928 6.0E-16
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 774 928 6.0E-16
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 717 973 7.0E-16
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 715 928 7.0E-16
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 731 954 7.0E-16
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 715 928 7.0E-16
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 784 927 8.0E-16
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 715 928 8.0E-16
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 720 929 8.0E-16
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 784 927 8.0E-16
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 716 930 8.0E-16
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 715 928 8.0E-16
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 718 929 8.0E-16
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 715 928 8.0E-16
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 784 927 8.0E-16
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 787 930 9.0E-16
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 715 928 9.0E-16
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 715 928 9.0E-16
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 718 938 9.0E-16
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 716 930 1.0E-15
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 714 951 1.0E-15
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 718 929 1.0E-15
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 724 929 1.0E-15
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 774 928 1.0E-15
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 774 928 1.0E-15
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 718 929 1.0E-15
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 718 928 1.0E-15
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 716 929 1.0E-15
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 718 926 1.0E-15
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 718 927 1.0E-15
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 715 928 1.0E-15
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 718 927 1.0E-15
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 711 928 1.0E-15
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 716 928 1.0E-15
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 724 927 2.0E-15
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 782 951 2.0E-15
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 718 926 2.0E-15
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 716 930 2.0E-15
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 737 927 2.0E-15
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 716 927 2.0E-15
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 706 944 2.0E-15
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 718 928 2.0E-15
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 784 927 2.0E-15
sp|Q9JIH7|WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus GN=Wnk1 PE=1 SV=2 717 930 2.0E-15
sp|P83741|WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus GN=Wnk1 PE=1 SV=2 717 930 2.0E-15
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 784 927 2.0E-15
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 782 951 2.0E-15
sp|Q9H4A3|WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens GN=WNK1 PE=1 SV=2 717 930 3.0E-15
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 718 969 3.0E-15
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 784 927 4.0E-15
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 762 933 4.0E-15
sp|Q9M1Z9|LRK58_ARATH Putative L-type lectin-domain containing receptor kinase V.8 OS=Arabidopsis thaliana GN=LECRK58 PE=3 SV=1 718 929 4.0E-15
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 701 927 4.0E-15
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 784 927 5.0E-15
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 724 927 5.0E-15
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 709 927 5.0E-15
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 716 928 5.0E-15
sp|P08018|PBS2_YEAST MAP kinase kinase PBS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBS2 PE=1 SV=4 734 928 5.0E-15
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 679 927 5.0E-15
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 716 928 5.0E-15
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 716 929 5.0E-15
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 716 928 6.0E-15
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 716 928 6.0E-15
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 718 927 7.0E-15
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 714 944 7.0E-15
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 717 928 7.0E-15
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 718 954 8.0E-15
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 685 943 8.0E-15
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 716 929 8.0E-15
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 716 928 8.0E-15
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 774 927 8.0E-15
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 784 928 9.0E-15
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 784 927 9.0E-15
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 716 929 9.0E-15
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 724 929 9.0E-15
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 693 929 9.0E-15
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 716 928 9.0E-15
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 743 953 1.0E-14
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 784 927 1.0E-14
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 716 927 1.0E-14
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 716 929 1.0E-14
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 717 928 1.0E-14
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 716 927 1.0E-14
sp|Q91447|MP2K1_SERCA Dual specificity mitogen-activated protein kinase kinase 1 (Fragment) OS=Serinus canaria GN=MAP2K1 PE=2 SV=1 718 928 1.0E-14
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 716 926 1.0E-14
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 691 928 1.0E-14
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 716 927 1.0E-14
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 716 928 1.0E-14
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 716 928 1.0E-14
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 716 928 1.0E-14
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 708 929 1.0E-14
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 716 930 1.0E-14
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 717 927 1.0E-14
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 716 927 1.0E-14
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 716 928 2.0E-14
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 716 927 2.0E-14
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 772 927 2.0E-14
sp|Q05116|MP2K1_XENLA Dual specificity mitogen-activated protein kinase kinase 1 OS=Xenopus laevis GN=map2k1 PE=1 SV=2 718 928 2.0E-14
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 667 927 2.0E-14
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 716 928 2.0E-14
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 784 927 2.0E-14
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 770 927 2.0E-14
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 708 929 2.0E-14
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 713 931 2.0E-14
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 716 928 2.0E-14
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 716 928 2.0E-14
sp|Q63980|MP2K1_CRIGR Dual specificity mitogen-activated protein kinase kinase 1 OS=Cricetulus griseus GN=MAP2K1 PE=1 SV=1 718 929 2.0E-14
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 705 928 2.0E-14
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 716 928 3.0E-14
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 724 927 3.0E-14
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 774 927 3.0E-14
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 792 927 3.0E-14
sp|O14132|PIT1_SCHPO Sporulation protein kinase pit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pit1 PE=1 SV=1 713 928 3.0E-14
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 716 928 3.0E-14
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 716 927 3.0E-14
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 712 928 3.0E-14
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 716 931 3.0E-14
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 774 927 3.0E-14
sp|Q01986|MP2K1_RAT Dual specificity mitogen-activated protein kinase kinase 1 OS=Rattus norvegicus GN=Map2k1 PE=1 SV=2 718 929 3.0E-14
sp|P29678|MP2K1_RABIT Dual specificity mitogen-activated protein kinase kinase 1 OS=Oryctolagus cuniculus GN=MAP2K1 PE=1 SV=2 718 929 3.0E-14
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 709 928 3.0E-14
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 703 928 3.0E-14
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 716 928 3.0E-14
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 716 927 3.0E-14
sp|P31938|MP2K1_MOUSE Dual specificity mitogen-activated protein kinase kinase 1 OS=Mus musculus GN=Map2k1 PE=1 SV=2 718 929 3.0E-14
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 716 929 3.0E-14
sp|Q02750|MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens GN=MAP2K1 PE=1 SV=2 718 929 3.0E-14
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 786 969 3.0E-14
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 716 928 3.0E-14
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 746 927 3.0E-14
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 724 929 3.0E-14
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 782 928 4.0E-14
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 714 955 4.0E-14
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 716 929 4.0E-14
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 715 928 4.0E-14
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 782 928 4.0E-14
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 783 949 4.0E-14
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 716 927 4.0E-14
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 717 928 4.0E-14
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 774 927 5.0E-14
sp|O04534|LRK51_ARATH Putative L-type lectin-domain containing receptor kinase V.1 OS=Arabidopsis thaliana GN=LECRK51 PE=3 SV=1 718 929 5.0E-14
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 782 951 5.0E-14
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 720 928 5.0E-14
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 715 928 6.0E-14
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 716 927 6.0E-14
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 717 928 6.0E-14
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 718 928 6.0E-14
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 715 927 6.0E-14
sp|Q3UH66|WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus GN=Wnk2 PE=1 SV=2 713 930 7.0E-14
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 716 927 7.0E-14
sp|Q96285|LRK55_ARATH L-type lectin-domain containing receptor kinase V.5 OS=Arabidopsis thaliana GN=LECRK55 PE=1 SV=1 718 929 7.0E-14
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 716 927 7.0E-14
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 742 928 7.0E-14
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 714 952 8.0E-14
sp|Q24324|DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster GN=Dsor1 PE=1 SV=2 716 931 8.0E-14
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 718 931 8.0E-14
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 716 929 8.0E-14
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 709 928 8.0E-14
sp|O22833|LRK54_ARATH L-type lectin-domain containing receptor kinase V.4 OS=Arabidopsis thaliana GN=LECRK54 PE=2 SV=1 722 969 8.0E-14
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 715 928 8.0E-14
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 724 927 9.0E-14
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 762 928 1.0E-13
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 716 931 1.0E-13
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 716 929 1.0E-13
sp|Q9P2K8|E2AK4_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Homo sapiens GN=EIF2AK4 PE=1 SV=3 808 930 1.0E-13
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 774 927 1.0E-13
sp|Q9CAL3|CRK2_ARATH Cysteine-rich receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=2 SV=1 718 956 1.0E-13
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 716 968 1.0E-13
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 724 927 1.0E-13
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 806 927 1.0E-13
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 717 927 1.0E-13
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 715 928 1.0E-13
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 716 927 1.0E-13
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 716 933 1.0E-13
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 724 927 1.0E-13
sp|Q8NU97|PKN2_CORGL Serine/threonine-protein kinases PknA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknA PE=3 SV=1 763 977 1.0E-13
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 704 929 2.0E-13
sp|Q54D75|Y2550_DICDI Probable cyclin-dependent serine/threonine-protein kinase DDB_G0292550 OS=Dictyostelium discoideum GN=DDB_G0292550 PE=3 SV=1 718 927 2.0E-13
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 716 927 2.0E-13
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 724 927 2.0E-13
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 717 927 2.0E-13
sp|Q9Y3S1|WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens GN=WNK2 PE=1 SV=4 713 930 2.0E-13
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 782 951 2.0E-13
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 713 931 2.0E-13
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 759 928 2.0E-13
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 717 927 2.0E-13
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 718 927 2.0E-13
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 713 931 2.0E-13
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 781 930 2.0E-13
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 792 932 2.0E-13
sp|Q80UE6|WNK4_MOUSE Serine/threonine-protein kinase WNK4 OS=Mus musculus GN=Wnk4 PE=1 SV=1 715 930 2.0E-13
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 711 928 2.0E-13
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 701 927 2.0E-13
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 701 927 2.0E-13
sp|Q03428|NRKB_TRYBB Putative serine/threonine-protein kinase B OS=Trypanosoma brucei brucei GN=NRKB PE=2 SV=2 792 927 2.0E-13
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 718 929 2.0E-13
sp|Q96J92|WNK4_HUMAN Serine/threonine-protein kinase WNK4 OS=Homo sapiens GN=WNK4 PE=1 SV=1 715 930 2.0E-13
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 715 928 2.0E-13
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 716 933 2.0E-13
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 704 929 2.0E-13
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 720 928 2.0E-13
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 716 927 2.0E-13
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 716 933 2.0E-13
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 717 937 2.0E-13
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 701 927 2.0E-13
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 718 927 2.0E-13
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 717 937 2.0E-13
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 714 944 2.0E-13
sp|Q7TPK6|WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus GN=Wnk4 PE=1 SV=3 715 930 2.0E-13
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 717 927 2.0E-13
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 795 927 2.0E-13
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 730 927 3.0E-13
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 716 927 3.0E-13
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 704 929 3.0E-13
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 724 927 3.0E-13
sp|O42376|MK12_DANRE Mitogen-activated protein kinase 12 OS=Danio rerio GN=mapk12 PE=2 SV=1 691 972 3.0E-13
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 715 928 3.0E-13
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 717 927 3.0E-13
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 763 928 3.0E-13
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 716 927 3.0E-13
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 718 927 3.0E-13
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 717 926 3.0E-13
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 746 927 3.0E-13
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 792 928 3.0E-13
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 716 923 3.0E-13
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 784 928 4.0E-13
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 716 927 4.0E-13
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 718 927 4.0E-13
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 762 952 4.0E-13
sp|Q80XP9|WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus GN=Wnk3 PE=1 SV=3 717 928 4.0E-13
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 718 927 4.0E-13
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 718 927 4.0E-13
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 717 927 4.0E-13
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 716 929 4.0E-13
sp|Q9KIG4|PK1_STRTO Serine/threonine-protein kinase PK-1 OS=Streptomyces toyocaensis GN=spk1 PE=1 SV=1 701 927 4.0E-13
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 715 928 4.0E-13
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 718 926 4.0E-13
sp|Q9BYP7|WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens GN=WNK3 PE=1 SV=3 717 928 4.0E-13
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 697 928 4.0E-13
sp|O62618|MK14A_DROME Mitogen-activated protein kinase 14A OS=Drosophila melanogaster GN=Mpk2 PE=1 SV=1 759 927 4.0E-13
sp|Q9LHI7|NEK7_ARATH Serine/threonine-protein kinase Nek7 OS=Arabidopsis thaliana GN=NEK7 PE=2 SV=1 758 930 4.0E-13
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 716 929 4.0E-13
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 704 929 5.0E-13
sp|A1CAF0|MPKC_ASPCL Mitogen-activated protein kinase mpkC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mpkC PE=3 SV=1 752 927 5.0E-13
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 724 927 5.0E-13
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 774 927 5.0E-13
sp|Q9QZ05|E2AK4_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 4 OS=Mus musculus GN=Eif2ak4 PE=1 SV=2 808 930 5.0E-13
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 716 933 5.0E-13
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 704 929 6.0E-13
sp|Q5A961|PRK1_CANAL Actin-regulating kinase PRK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRK1 PE=1 SV=1 782 928 6.0E-13
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 718 927 6.0E-13
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 716 927 6.0E-13
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 724 927 6.0E-13
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 716 949 6.0E-13
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 706 928 6.0E-13
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 724 927 7.0E-13
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 717 927 7.0E-13
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 782 931 7.0E-13
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 717 927 7.0E-13
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 784 927 7.0E-13
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 717 937 7.0E-13
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 718 927 8.0E-13
sp|Q9HG11|MPKC_EMENI Mitogen-activated protein kinase mpkC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpkC PE=2 SV=2 760 927 8.0E-13
sp|O22834|LRK53_ARATH Probable L-type lectin-domain containing receptor kinase V.3 OS=Arabidopsis thaliana GN=LECRK53 PE=3 SV=1 722 930 8.0E-13
sp|Q90321|MP2K2_CYPCA Dual specificity mitogen-activated protein kinase kinase 2 OS=Cyprinus carpio GN=map2k2 PE=2 SV=1 716 928 8.0E-13
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 625 927 8.0E-13
sp|O43077|MDE3_SCHPO Sporulation protein kinase mde3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde3 PE=3 SV=1 714 929 9.0E-13
sp|P0CY25|STE7_CANAX Serine/threonine-protein kinase STE7 homolog OS=Candida albicans GN=STE7 PE=3 SV=1 783 940 9.0E-13
sp|C4YLK8|STE7_CANAW Serine/threonine-protein kinase STE7 homolog OS=Candida albicans (strain WO-1) GN=HST7 PE=3 SV=1 783 940 9.0E-13
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 741 952 9.0E-13
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 713 929 9.0E-13
sp|Q9XT09|MP2K1_PANTR Dual specificity mitogen-activated protein kinase kinase 1 OS=Pan troglodytes GN=MAP2K1 PE=2 SV=3 718 929 1.0E-12
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 717 928 1.0E-12
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 716 979 1.0E-12
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 718 929 1.0E-12
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 786 969 1.0E-12
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 717 927 1.0E-12
sp|Q5A6T5|STE7_CANAL Serine/threonine-protein kinase STE7 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST7 PE=3 SV=1 783 940 1.0E-12
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 717 927 1.0E-12
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 763 960 1.0E-12
sp|Q966Y3|JNK_SUBDO Stress-activated protein kinase JNK OS=Suberites domuncula GN=JNK PE=2 SV=1 763 934 1.0E-12
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 792 931 1.0E-12
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 745 972 1.0E-12
sp|P43294|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2 717 929 1.0E-12
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 774 949 1.0E-12
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 727 929 1.0E-12
sp|O61443|MK14B_DROME Mitogen-activated protein kinase 14B OS=Drosophila melanogaster GN=p38b PE=1 SV=1 763 927 1.0E-12
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 716 933 1.0E-12
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 705 927 1.0E-12
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 716 928 1.0E-12
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 717 928 1.0E-12
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 724 927 1.0E-12
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 716 929 1.0E-12
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 718 928 2.0E-12
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 703 928 2.0E-12
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 704 928 2.0E-12
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 722 929 2.0E-12
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 716 928 2.0E-12
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 727 927 2.0E-12
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 717 931 2.0E-12
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 718 944 2.0E-12
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 718 931 2.0E-12
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 716 928 2.0E-12
sp|Q06309|CRK1_LEIME Cell division protein kinase 2 homolog CRK1 OS=Leishmania mexicana GN=CRK1 PE=2 SV=1 717 928 2.0E-12
sp|P84199|NEKL4_CAEEL Serine/threonine-protein kinase D1044.8 OS=Caenorhabditis elegans GN=nekl-4 PE=3 SV=2 718 928 2.0E-12
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 774 949 2.0E-12
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 716 933 2.0E-12
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 746 927 2.0E-12
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 718 928 2.0E-12
sp|P40417|ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster GN=rl PE=1 SV=3 717 930 2.0E-12
sp|Q8I7M8|CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans GN=pct-1 PE=1 SV=1 716 933 2.0E-12
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 745 972 2.0E-12
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 718 928 2.0E-12
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 704 929 2.0E-12
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 718 944 2.0E-12
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 729 927 2.0E-12
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 729 927 2.0E-12
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 729 927 2.0E-12
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 704 929 2.0E-12
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 724 928 2.0E-12
sp|Q0CIC7|MPKC_ASPTN Mitogen-activated protein kinase mpkC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mpkC PE=3 SV=2 737 931 2.0E-12
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 718 928 2.0E-12
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 704 929 2.0E-12
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 783 928 3.0E-12
sp|Q9XID3|Y1343_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300 OS=Arabidopsis thaliana GN=At1g34300 PE=2 SV=1 722 929 3.0E-12
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 722 928 3.0E-12
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 717 932 3.0E-12
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 716 927 3.0E-12
sp|A1DES4|MPKC_NEOFI Mitogen-activated protein kinase mpkC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mpkc PE=3 SV=2 752 927 3.0E-12
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 704 929 3.0E-12
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 708 931 3.0E-12
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 722 927 3.0E-12
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 718 928 3.0E-12
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 717 937 3.0E-12
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 704 929 3.0E-12
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 704 929 3.0E-12
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 704 929 3.0E-12
sp|O44408|KGB1_CAEEL GLH-binding kinase 1 OS=Caenorhabditis elegans GN=kgb-1 PE=1 SV=2 760 945 3.0E-12
sp|Q9WTU6|MK09_MOUSE Mitogen-activated protein kinase 9 OS=Mus musculus GN=Mapk9 PE=1 SV=2 763 933 3.0E-12
sp|P36507|MP2K2_HUMAN Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens GN=MAP2K2 PE=1 SV=1 781 929 3.0E-12
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 746 927 3.0E-12
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 718 928 3.0E-12
sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPS1 PE=1 SV=2 717 927 3.0E-12
sp|Q9Z2A6|MK15_RAT Mitogen-activated protein kinase 15 OS=Rattus norvegicus GN=Mapk15 PE=1 SV=2 705 927 3.0E-12
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 714 927 3.0E-12
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 718 884 3.0E-12
sp|A2QN07|MPKC_ASPNC Mitogen-activated protein kinase mpkC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mpkC PE=3 SV=1 752 927 4.0E-12
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 782 929 4.0E-12
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 716 929 4.0E-12
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 746 927 4.0E-12
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 715 928 4.0E-12
sp|P06784|STE7_YEAST Serine/threonine-protein kinase STE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE7 PE=1 SV=1 782 929 4.0E-12
sp|Q54RR9|Y9844_DICDI Probable serine/threonine-protein kinase DDB_G0282963 OS=Dictyostelium discoideum GN=DDB_G0282963 PE=3 SV=1 721 932 4.0E-12
sp|P27638|SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spk1 PE=2 SV=1 709 927 4.0E-12
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 701 966 4.0E-12
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 714 970 5.0E-12
sp|P47812|MK14_XENLA Mitogen-activated protein kinase 14 OS=Xenopus laevis GN=mapk14 PE=2 SV=1 763 927 5.0E-12
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 795 927 5.0E-12
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 700 929 5.0E-12
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 716 928 5.0E-12
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 708 931 5.0E-12
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 706 928 6.0E-12
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 775 929 6.0E-12
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 716 927 6.0E-12
sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens GN=OBSCN PE=1 SV=3 714 923 6.0E-12
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 716 927 6.0E-12
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 782 927 6.0E-12
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 704 929 6.0E-12
sp|P36506|MP2K2_RAT Dual specificity mitogen-activated protein kinase kinase 2 OS=Rattus norvegicus GN=Map2k2 PE=1 SV=1 781 928 6.0E-12
sp|O59853|HOG2_ZYGRO Mitogen-activated protein kinase HOG2 OS=Zygosaccharomyces rouxii GN=HOG2 PE=3 SV=1 715 927 7.0E-12
sp|Q63932|MP2K2_MOUSE Dual specificity mitogen-activated protein kinase kinase 2 OS=Mus musculus GN=Map2k2 PE=1 SV=2 781 928 7.0E-12
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 776 929 7.0E-12
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 704 929 7.0E-12
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 704 929 7.0E-12
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 711 927 7.0E-12
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 706 928 7.0E-12
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 754 928 7.0E-12
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 706 928 7.0E-12
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 776 929 7.0E-12
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 721 927 7.0E-12
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 717 907 7.0E-12
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 757 927 7.0E-12
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 724 927 7.0E-12
sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens GN=LATS2 PE=1 SV=2 718 884 7.0E-12
sp|Q7TSJ6|LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus GN=Lats2 PE=1 SV=1 718 884 7.0E-12
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 754 928 8.0E-12
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 717 931 8.0E-12
sp|Q6FIU2|HOG1_CANGA Mitogen-activated protein kinase HOG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HOG1 PE=3 SV=1 729 927 8.0E-12
sp|Q99078|FUZ7_USTMA Dual specificity protein kinase FUZ7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FUZ7 PE=3 SV=2 777 928 8.0E-12
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 796 931 8.0E-12
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 721 927 8.0E-12
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 795 928 8.0E-12
sp|P9WI81|PKNB_MYCTU Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknB PE=1 SV=1 714 927 8.0E-12
sp|P9WI80|PKNB_MYCTO Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknB PE=3 SV=1 714 927 8.0E-12
sp|P0A5S5|PKNB_MYCBO Serine/threonine-protein kinase PknB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknB PE=3 SV=1 714 927 8.0E-12
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 716 929 8.0E-12
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 754 928 9.0E-12
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 716 924 9.0E-12
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 715 927 9.0E-12
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 752 927 9.0E-12
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 716 927 9.0E-12
sp|Q2U469|MPKC_ASPOR Mitogen-activated protein kinase mpkC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpkC PE=3 SV=2 760 927 9.0E-12
sp|Q8QHK8|MK08_XENLA Mitogen-activated protein kinase 8 OS=Xenopus laevis GN=mapk8 PE=2 SV=2 763 933 1.0E-11
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 716 927 1.0E-11
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 707 929 1.0E-11
sp|Q17446|PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans GN=pmk-1 PE=1 SV=1 745 927 1.0E-11
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 752 927 1.0E-11
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 795 928 1.0E-11
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 716 927 1.0E-11
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 710 939 8.0E-11
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 729 939 9.0E-11
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 729 939 1.0E-10
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 728 939 2.0E-10
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 729 938 4.0E-10
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 718 947 1.0E-09
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 729 946 2.0E-09
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 714 923 3.0E-08
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 783 938 5.0E-07
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 783 938 5.0E-07
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 712 947 5.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 783 938 2.0E-06
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 783 938 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6429
MSFSNGSGGTLALPSPTHAHHMDVTSAVRSLRHSISRSPSKFLSRTGTSQSVEGSPRPPTSRRHTITPQRSNSAP
LNAQTAPATVSHPAALSQPFVFTPLRPGAKLSLRSVKSAKSLSPSRALTRSRASPRSPLKRALNNTSDLGNSASV
TQPSGLGAGKENTADQKASPTPTPPTSAARESRHSLHLDVTGSASQYSFLKSPNASGDLCMTPATGTLKRSDATM
NLDHSHHGSPVAKRRSLHGISTFDAAPDFNVWQRRSSLDASPNFDILEDSQSEYELSGAAAGRGRSEPAEMPQAC
VLGSTQAPNLPKRSSSLRKSTLQQRHGDKLSWGRRSGERQLAQLTCEAPPNARARPRLSTDQFLPPALSRDSPFS
MGNPLPNASIHVAHGATNQPHPLSKTLTTSSSGNRLMEETAIRKSQKPMGDKDKTHPFSQSLPLNAVRPTARPLE
EHTKAATTPTQPANLWMGAFNSTGLVSKVNRNFDEEAETRMAPPDTPCKRHANPFATFPPPAVSAMKRRGNNRNS
FGGMPSTPLGRPYSRGLESLGRPAKGLSIFQRASGAQHSRRSSLLGLEGDERFLFGDGGDLCVDGDGPTTPSKGS
LAPSLSNLSEQSLESPSAQRTFVFPLSSAAKTSRRREPSSSPMHGQRTPRTPQENLLPLDTSRLSISQAADGQVE
RCAPPPVTPTAGRDFRSSTGIFATPVNARMSNPDPDASLHERFDKVEQVGKGEFSTVYRVTKTELRYALAVGEDS
SLSCSPAKNQVYAVKKSRHPYLGQRDRQIKFREVQALRAMRNSEHIVQYVDSWEDDDHLYIQTEFCEEGSLDKFL
GNVGRGGRLDDFRIFKILQDLCLGLKEIHEAGFMHLDIKPANILINFEGALKIGDFGLAQENWPPRKIDMEGDRE
YMAPEMLKGLVDKGADIFSLGLMVLEMAANVVLPDNGPSWIALRSGDLSEVPSLTWTPSIEAQQDVLNADTREET
GVFGPAEASKDHGPPRFMIEAWHASSLDSIVRWMTMERSEDRPLAEQVLSLEGVRWVGERRNAPATVYEGSWGPT
DRFAAAVPMASSVSIAEDSDTEMVDV*
Coding >OphauB2|6429
ATGTCCTTTTCGAATGGCAGTGGAGGCACCTTGGCTCTGCCCTCGCCCACGCATGCTCATCACATGGACGTGACG
TCGGCCGTTCGCAGCCTCCGCCACTCCATTTCGCGGTCTCCTTCCAAGTTTTTGTCCCGCACGGGCACCTCGCAG
AGCGTCGAGGGCTCTCCTCGCCCACCAACTTCTAGGCGCCATACCATTACGCCACAGCGCTCAAACTCGGCTCCT
CTCAATGCTCAGACAGCACCTGCTACAGTGTCGCACCCTGCCGCTTTGAGCCAGCCCTTCGTCTTTACGCCTCTG
CGCCCTGGAGCCAAGTTGTCGTTGCGCTCAGTCAAGTCTGCAAAGTCACTGTCGCCTTCGCGCGCCTTGACGCGA
TCACGTGCTTCGCCCAGAAGTCCCTTGAAGCGCGCCCTCAATAACACTTCAGACTTGGGTAATTCTGCTTCTGTT
ACTCAGCCCTCGGGCCTTGGAGCAGGAAAAGAGAATACAGCGGACCAGAAGGCCTCGCCTACACCAACACCACCT
ACATCAGCCGCTAGAGAGTCTCGGCACAGTCTGCACCTGGACGTGACGGGAAGTGCCTCGCAGTACTCATTTCTC
AAGTCGCCCAACGCCAGTGGCGACCTTTGCATGACTCCTGCAACTGGGACGCTCAAGCGCAGCGATGCCACTATG
AATCTCGATCACTCACATCACGGAAGCCCCGTTGCCAAACGGCGGAGTTTGCACGGCATCTCCACCTTTGATGCC
GCCCCAGATTTCAACGTTTGGCAAAGAAGAAGCAGTCTGGACGCGTCGCCCAACTTTGACATACTTGAGGACTCG
CAGTCCGAGTATGAGTTGTCTGGAGCTGCCGCTGGTCGTGGTCGCTCGGAGCCGGCTGAGATGCCCCAGGCTTGT
GTTTTGGGGTCTACTCAGGCGCCCAACTTGCCTAAGAGGTCTTCATCGCTCCGAAAGTCGACGCTGCAGCAGCGG
CATGGAGATAAGCTGTCGTGGGGCCGGAGGTCGGGCGAGCGCCAGCTTGCGCAACTGACTTGCGAGGCGCCGCCA
AACGCCAGGGCTCGGCCACGTTTGTCAACTGACCAGTTTCTGCCCCCGGCTCTTTCCCGTGACAGTCCCTTCTCA
ATGGGCAATCCCTTGCCCAATGCGTCTATACATGTTGCACACGGCGCCACCAATCAGCCACATCCGCTCTCCAAG
ACGCTGACCACATCCTCATCTGGAAATAGGCTGATGGAGGAGACGGCTATTCGCAAGTCACAAAAACCCATGGGA
GACAAGGATAAGACGCATCCATTTTCTCAGTCGCTGCCTCTGAATGCTGTTCGGCCGACGGCTCGCCCGCTTGAA
GAGCATACCAAGGCGGCCACAACGCCCACTCAGCCCGCCAATCTCTGGATGGGTGCTTTCAACTCGACGGGTCTC
GTGTCCAAAGTAAACCGGAATTTTGACGAGGAGGCTGAGACGAGGATGGCGCCACCTGATACGCCCTGCAAAAGG
CACGCCAACCCCTTTGCAACATTTCCTCCTCCAGCAGTAAGTGCCATGAAGCGGAGGGGCAACAACCGCAACTCG
TTTGGCGGAATGCCCTCGACGCCACTGGGAAGGCCATATAGCCGTGGCTTGGAATCGCTGGGGCGGCCTGCAAAG
GGCCTGTCAATTTTTCAGCGGGCATCGGGCGCGCAGCACTCGCGCCGTAGCAGTCTTTTGGGGCTCGAGGGAGAC
GAGCGCTTCTTGTTTGGCGATGGTGGCGACTTGTGCGTGGACGGCGATGGCCCAACTACACCGTCCAAGGGCTCG
CTGGCACCCAGTCTCAGTAATTTGAGCGAACAATCGCTCGAGAGCCCAAGTGCACAGCGCACCTTTGTCTTTCCG
CTGTCGTCGGCCGCCAAGACGTCGCGACGGCGGGAACCGAGCTCGAGCCCTATGCATGGCCAGCGCACGCCTCGG
ACGCCGCAGGAAAACCTGCTTCCTCTGGACACGAGCCGCCTGTCCATATCGCAGGCGGCCGATGGCCAGGTGGAG
CGGTGTGCGCCTCCTCCGGTGACGCCGACGGCGGGACGTGATTTCCGCTCATCAACGGGCATATTCGCGACACCG
GTGAATGCGCGGATGAGTAACCCAGATCCGGACGCGAGCCTGCACGAGCGCTTCGACAAGGTGGAGCAAGTGGGC
AAGGGAGAGTTTTCAACTGTTTACCGCGTGACCAAGACGGAGCTGCGGTACGCGCTGGCAGTTGGCGAGGATAGC
AGCCTGTCATGCAGTCCCGCGAAGAACCAGGTGTACGCGGTCAAGAAGAGCAGGCACCCATATCTGGGCCAACGC
GACCGACAAATCAAGTTTCGCGAGGTTCAGGCACTTCGGGCCATGCGTAACTCGGAGCACATTGTGCAATATGTC
GACAGCTGGGAAGACGATGACCACTTGTATATTCAGACTGAATTTTGCGAAGAAGGATCGCTCGACAAGTTTTTG
GGCAACGTGGGGCGGGGTGGGAGATTGGATGATTTCCGCATCTTCAAAATCTTGCAAGATCTTTGTTTGGGCTTG
AAGGAAATCCACGAAGCTGGATTCATGCACCTGGATATAAAGCCGGCCAACATCTTGATCAATTTTGAGGGCGCC
CTCAAGATTGGTGACTTTGGGCTGGCCCAGGAGAACTGGCCGCCACGCAAGATTGACATGGAGGGCGATCGTGAA
TACATGGCACCCGAGATGCTTAAAGGCCTGGTGGACAAGGGTGCTGATATTTTTTCGCTTGGCCTCATGGTTCTC
GAAATGGCGGCCAATGTGGTGCTGCCTGACAATGGGCCCAGCTGGATCGCGCTGCGCTCAGGCGACTTGTCCGAG
GTGCCTAGCCTGACTTGGACACCGTCGATTGAGGCGCAGCAAGACGTGCTCAACGCAGATACTAGGGAGGAGACT
GGTGTTTTTGGACCGGCTGAAGCTTCCAAGGATCATGGGCCTCCACGGTTTATGATTGAGGCGTGGCATGCCAGT
TCGCTCGACTCGATTGTCAGATGGATGACGATGGAGCGGTCCGAGGACCGGCCCTTGGCGGAGCAAGTGTTGAGT
CTGGAGGGCGTGCGGTGGGTGGGAGAACGGCGCAATGCGCCTGCGACGGTGTATGAAGGCAGCTGGGGCCCGACG
GACAGATTTGCGGCGGCGGTGCCCATGGCATCTTCTGTTTCGATTGCTGAAGACAGCGACACGGAAATGGTTGAT
GTCTGA
Transcript >OphauB2|6429
ATGTCCTTTTCGAATGGCAGTGGAGGCACCTTGGCTCTGCCCTCGCCCACGCATGCTCATCACATGGACGTGACG
TCGGCCGTTCGCAGCCTCCGCCACTCCATTTCGCGGTCTCCTTCCAAGTTTTTGTCCCGCACGGGCACCTCGCAG
AGCGTCGAGGGCTCTCCTCGCCCACCAACTTCTAGGCGCCATACCATTACGCCACAGCGCTCAAACTCGGCTCCT
CTCAATGCTCAGACAGCACCTGCTACAGTGTCGCACCCTGCCGCTTTGAGCCAGCCCTTCGTCTTTACGCCTCTG
CGCCCTGGAGCCAAGTTGTCGTTGCGCTCAGTCAAGTCTGCAAAGTCACTGTCGCCTTCGCGCGCCTTGACGCGA
TCACGTGCTTCGCCCAGAAGTCCCTTGAAGCGCGCCCTCAATAACACTTCAGACTTGGGTAATTCTGCTTCTGTT
ACTCAGCCCTCGGGCCTTGGAGCAGGAAAAGAGAATACAGCGGACCAGAAGGCCTCGCCTACACCAACACCACCT
ACATCAGCCGCTAGAGAGTCTCGGCACAGTCTGCACCTGGACGTGACGGGAAGTGCCTCGCAGTACTCATTTCTC
AAGTCGCCCAACGCCAGTGGCGACCTTTGCATGACTCCTGCAACTGGGACGCTCAAGCGCAGCGATGCCACTATG
AATCTCGATCACTCACATCACGGAAGCCCCGTTGCCAAACGGCGGAGTTTGCACGGCATCTCCACCTTTGATGCC
GCCCCAGATTTCAACGTTTGGCAAAGAAGAAGCAGTCTGGACGCGTCGCCCAACTTTGACATACTTGAGGACTCG
CAGTCCGAGTATGAGTTGTCTGGAGCTGCCGCTGGTCGTGGTCGCTCGGAGCCGGCTGAGATGCCCCAGGCTTGT
GTTTTGGGGTCTACTCAGGCGCCCAACTTGCCTAAGAGGTCTTCATCGCTCCGAAAGTCGACGCTGCAGCAGCGG
CATGGAGATAAGCTGTCGTGGGGCCGGAGGTCGGGCGAGCGCCAGCTTGCGCAACTGACTTGCGAGGCGCCGCCA
AACGCCAGGGCTCGGCCACGTTTGTCAACTGACCAGTTTCTGCCCCCGGCTCTTTCCCGTGACAGTCCCTTCTCA
ATGGGCAATCCCTTGCCCAATGCGTCTATACATGTTGCACACGGCGCCACCAATCAGCCACATCCGCTCTCCAAG
ACGCTGACCACATCCTCATCTGGAAATAGGCTGATGGAGGAGACGGCTATTCGCAAGTCACAAAAACCCATGGGA
GACAAGGATAAGACGCATCCATTTTCTCAGTCGCTGCCTCTGAATGCTGTTCGGCCGACGGCTCGCCCGCTTGAA
GAGCATACCAAGGCGGCCACAACGCCCACTCAGCCCGCCAATCTCTGGATGGGTGCTTTCAACTCGACGGGTCTC
GTGTCCAAAGTAAACCGGAATTTTGACGAGGAGGCTGAGACGAGGATGGCGCCACCTGATACGCCCTGCAAAAGG
CACGCCAACCCCTTTGCAACATTTCCTCCTCCAGCAGTAAGTGCCATGAAGCGGAGGGGCAACAACCGCAACTCG
TTTGGCGGAATGCCCTCGACGCCACTGGGAAGGCCATATAGCCGTGGCTTGGAATCGCTGGGGCGGCCTGCAAAG
GGCCTGTCAATTTTTCAGCGGGCATCGGGCGCGCAGCACTCGCGCCGTAGCAGTCTTTTGGGGCTCGAGGGAGAC
GAGCGCTTCTTGTTTGGCGATGGTGGCGACTTGTGCGTGGACGGCGATGGCCCAACTACACCGTCCAAGGGCTCG
CTGGCACCCAGTCTCAGTAATTTGAGCGAACAATCGCTCGAGAGCCCAAGTGCACAGCGCACCTTTGTCTTTCCG
CTGTCGTCGGCCGCCAAGACGTCGCGACGGCGGGAACCGAGCTCGAGCCCTATGCATGGCCAGCGCACGCCTCGG
ACGCCGCAGGAAAACCTGCTTCCTCTGGACACGAGCCGCCTGTCCATATCGCAGGCGGCCGATGGCCAGGTGGAG
CGGTGTGCGCCTCCTCCGGTGACGCCGACGGCGGGACGTGATTTCCGCTCATCAACGGGCATATTCGCGACACCG
GTGAATGCGCGGATGAGTAACCCAGATCCGGACGCGAGCCTGCACGAGCGCTTCGACAAGGTGGAGCAAGTGGGC
AAGGGAGAGTTTTCAACTGTTTACCGCGTGACCAAGACGGAGCTGCGGTACGCGCTGGCAGTTGGCGAGGATAGC
AGCCTGTCATGCAGTCCCGCGAAGAACCAGGTGTACGCGGTCAAGAAGAGCAGGCACCCATATCTGGGCCAACGC
GACCGACAAATCAAGTTTCGCGAGGTTCAGGCACTTCGGGCCATGCGTAACTCGGAGCACATTGTGCAATATGTC
GACAGCTGGGAAGACGATGACCACTTGTATATTCAGACTGAATTTTGCGAAGAAGGATCGCTCGACAAGTTTTTG
GGCAACGTGGGGCGGGGTGGGAGATTGGATGATTTCCGCATCTTCAAAATCTTGCAAGATCTTTGTTTGGGCTTG
AAGGAAATCCACGAAGCTGGATTCATGCACCTGGATATAAAGCCGGCCAACATCTTGATCAATTTTGAGGGCGCC
CTCAAGATTGGTGACTTTGGGCTGGCCCAGGAGAACTGGCCGCCACGCAAGATTGACATGGAGGGCGATCGTGAA
TACATGGCACCCGAGATGCTTAAAGGCCTGGTGGACAAGGGTGCTGATATTTTTTCGCTTGGCCTCATGGTTCTC
GAAATGGCGGCCAATGTGGTGCTGCCTGACAATGGGCCCAGCTGGATCGCGCTGCGCTCAGGCGACTTGTCCGAG
GTGCCTAGCCTGACTTGGACACCGTCGATTGAGGCGCAGCAAGACGTGCTCAACGCAGATACTAGGGAGGAGACT
GGTGTTTTTGGACCGGCTGAAGCTTCCAAGGATCATGGGCCTCCACGGTTTATGATTGAGGCGTGGCATGCCAGT
TCGCTCGACTCGATTGTCAGATGGATGACGATGGAGCGGTCCGAGGACCGGCCCTTGGCGGAGCAAGTGTTGAGT
CTGGAGGGCGTGCGGTGGGTGGGAGAACGGCGCAATGCGCCTGCGACGGTGTATGAAGGCAGCTGGGGCCCGACG
GACAGATTTGCGGCGGCGGTGCCCATGGCATCTTCTGTTTCGATTGCTGAAGACAGCGACACGGAAATGGTTGAT
GTCTGA
Gene >OphauB2|6429
ATGTCCTTTTCGAATGGCAGTGGAGGCACCTTGGCTCTGCCCTCGCCCACGCATGCTCATCACATGGACGTGACG
TCGGCCGTTCGCAGCCTCCGCCACTCCATTTCGCGGTCTCCTTCCAAGTTTTTGTCCCGCACGGGCACCTCGCAG
AGCGTCGAGGGCTCTCCTCGCCCACCAACTTCTAGGCGCCATACCATTACGCCACAGCGCTCAAACTCGGCTCCT
CTCAATGCTCAGACAGCACCTGCTACAGTGTCGCACCCTGCCGCTTTGAGCCAGCCCTTCGTCTTTACGCCTCTG
CGCCCTGGAGCCAAGTTGTCGTTGCGCTCAGTCAAGTCTGCAAAGTCACTGTCGCCTTCGCGCGCCTTGACGCGA
TCACGTGCTTCGCCCAGAAGTCCCTTGAAGCGCGCCCTCAATAACACTTCAGACTTGGGTAATTCTGCTTCTGTT
ACTCAGCCCTCGGGCCTTGGAGCAGGAAAAGAGAATACAGCGGACCAGAAGGCCTCGCCTACACCAACACCACCT
ACATCAGCCGCTAGAGAGTCTCGGCACAGTCTGCACCTGGACGTGACGGGAAGTGCCTCGCAGTACTCATTTCTC
AAGTCGCCCAACGCCAGTGGCGACCTTTGCATGACTCCTGCAACTGGGACGCTCAAGCGCAGCGATGCCACTATG
AATCTCGATCACTCACATCACGGAAGCCCCGTTGCCAAACGGCGGAGTTTGCACGGCATCTCCACCTTTGATGCC
GCCCCAGATTTCAACGTTTGGCAAAGAAGAAGCAGTCTGGACGCGTCGCCCAACTTTGACATACTTGAGGACTCG
CAGTCCGAGTATGAGTTGTCTGGAGCTGCCGCTGGTCGTGGTCGCTCGGAGCCGGCTGAGATGCCCCAGGCTTGT
GTTTTGGGGTCTACTCAGGCGCCCAACTTGCCTAAGAGGTCTTCATCGCTCCGAAAGTCGACGCTGCAGCAGCGG
CATGGAGATAAGCTGTCGTGGGGCCGGAGGTCGGGCGAGCGCCAGCTTGCGCAACTGACTTGCGAGGCGCCGCCA
AACGCCAGGGCTCGGCCACGTTTGTCAACTGACCAGTTTCTGCCCCCGGCTCTTTCCCGTGACAGTCCCTTCTCA
ATGGGCAATCCCTTGCCCAATGCGTCTATACATGTTGCACACGGCGCCACCAATCAGCCACATCCGCTCTCCAAG
ACGCTGACCACATCCTCATCTGGAAATAGGCTGATGGAGGAGACGGCTATTCGCAAGTCACAAAAACCCATGGGA
GACAAGGATAAGACGCATCCATTTTCTCAGTCGCTGCCTCTGAATGCTGTTCGGCCGACGGCTCGCCCGCTTGAA
GAGCATACCAAGGCGGCCACAACGCCCACTCAGCCCGCCAATCTCTGGATGGGTGCTTTCAACTCGACGGGTCTC
GTGTCCAAAGTAAACCGGAATTTTGACGAGGAGGCTGAGACGAGGATGGCGCCACCTGATACGCCCTGCAAAAGG
CACGCCAACCCCTTTGCAACATTTCCTCCTCCAGCAGTAAGTGCCATGAAGCGGAGGGGCAACAACCGCAACTCG
TTTGGCGGAATGCCCTCGACGCCACTGGGAAGGCCATATAGCCGTGGCTTGGAATCGCTGGGGCGGCCTGCAAAG
GGCCTGTCAATTTTTCAGCGGGCATCGGGCGCGCAGCACTCGCGCCGTAGCAGTCTTTTGGGGCTCGAGGGAGAC
GAGCGCTTCTTGTTTGGCGATGGTGGCGACTTGTGCGTGGACGGCGATGGCCCAACTACACCGTCCAAGGGCTCG
CTGGCACCCAGTCTCAGTAATTTGAGCGAACAATCGCTCGAGAGCCCAAGTGCACAGCGCACCTTTGTCTTTCCG
CTGTCGTCGGCCGCCAAGACGTCGCGACGGCGGGAACCGAGCTGTGAGTCGAGCCCCGAGTGGTGCCGTGACATG
GACAGCTCGCAAATGGCGGCTGGCATGATGCTTGACGAGACGCAATCACCAGGTTTGCAGCACGCGCTTCGGCCA
TCTATTGGCCGCTCGCGAGCTCGCAAAAACCTTGCTGTGCCGTCTTTGTTGGCCTGTCAGCCTGCGCTCGCGTCG
TCCATTTCCCAGCCAGAGAGTGCGCTTGCTGAGATTACATTTGTTGATGCAGCGAGCCCTATGCATGGCCAGCGC
ACGCCTCGGACGCCGCAGGAAAACCTGCTTCCTCTGGACACGAGCCGCCTGTCCATATCGCAGGCGGCCGATGGC
CAGGTGGAGCGGTGTGCGCCTCCTCCGGTGACGCCGACGGCGGGACGTGATTTCCGCTCATCAACGGGCATATTC
GCGACACCGGTGAATGCGCGGATGAGTAACCCAGATCCGGACGCGAGCCTGCACGAGCGCTTCGACAAGGTGGAG
CAAGTGGGCAAGGGAGAGTTTTCAACTGTTTACCGCGTGACCAAGACGGAGCTGCGGTACGCGCTGGCAGTTGGC
GAGGATAGCAGCCTGTCATGCAGTCCCGCGAAGAACCAGGTGTACGCGGTCAAGAAGAGCAGGCACCCATATCTG
GGCCAACGCGACCGACAAATCAAGTTTCGCGAGGTTCAGGCACTTCGGGCCATGCGTAACTCGGAGCACATTGTG
CAATATGTCGACAGCTGGGAAGACGATGACCACTTGTATATTCAGACTGAATTTTGCGAAGAAGGATCGCTCGAC
AAGTTTTTGGGCAACGTGGGGCGGGGTGGGAGATTGGATGATTTCCGCATCTTCAAAATCTTGCAAGATCTTTGT
TTGGTGAGTTTTGGATGAGATGAAGAGAGCGGTGACGCTGGCAGTGCTGACTGGCTTTGGTTTGCAGGGCTTGAA
GGAAATCCACGAAGCTGGATTCATGCACCTGGATATAAAGCCGGCCAACATCTTGATCAATTTTGAGGGCGCCCT
CAAGATTGGTGACTTTGGGCTGGCCCAGGAGAACTGGCCGCCACGCAAGATTGACATGGAGGGCGATCGTGAATA
CATGGCACCCGAGATGCTTAAAGGCCTGGTGGACAAGGGTGCTGATATTTTTTCGCTTGGCCTCATGGTTCTCGA
AATGGCGGCCAATGTGGTGCTGCCTGACAATGGGCCCAGCTGGATCGCGCTGCGCTCAGGCGACTTGTCCGAGGT
GCCTAGCCTGACTTGGACACCGTCGATTGAGGCGCAGCAAGACGTGCTCAACGCAGATACTAGGGAGGAGACTGG
TGTTTTTGGACCGGCTGAAGCTTCCAAGGATCATGGGCCTCCACGGTTTATGATTGAGGCGTGGCATGCCAGTTC
GCTCGACTCGATTGTCAGATGGATGACGATGGAGCGGTCCGAGGACCGGCCCTTGGCGGAGCAAGTGTTGAGTCT
GGAGGGCGTGCGGTGGGTGGGAGAACGGCGCAATGCGCCTGCGACGGTGTATGAAGGCAGCTGGGGCCCGACGGA
CAGATTTGCGGCGGCGGTGCCCATGGCATCTTCTGTTTCGATTGCTGAAGACAGCGACACGGAAATGGTTGATGT
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail