Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6421
Gene name
LocationContig_59:86209..87109
Strand+
Gene length (bp)900
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1171
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|6421 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1028
Ophiocordyceps subramaniannii Hirsu2|1029
Ophiocordyceps subramaniannii Hirsu2|2484
Ophiocordyceps subramaniannii Hirsu2|2485
Ophiocordyceps subramaniannii Hirsu2|6060

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6421
MSWNSLPQELQLIILEFVADRTERDFENQLKFSPFATVCSFWQWFFETKTFWSLSLTQNDLWPFFNLVVGHRRKL
VKRIKMKEAEKWPDHVKGIGLELALANKMDTRNPGEGCKKMHVKALKEALNNSPVINFAWEDVDMQPEPMSFLNG
DDSSFTDGCLSCWEEYCLRYPWPLYRFPQDVMSRTLFDEKRVTRRLPILRIVDKLVIRFIRRNNVETPVVRWVLA
SLPRVGRVSRSFGQRTPRAQKNGKLVRWRRGSV*
Coding >OphauB2|6421
ATGTCCTGGAACTCGCTACCTCAGGAATTGCAACTCATCATACTCGAATTTGTAGCGGACCGAACCGAACGCGAC
TTTGAGAATCAACTCAAGTTCTCGCCCTTTGCCACGGTTTGCAGTTTCTGGCAATGGTTTTTTGAAACAAAGACG
TTTTGGAGCCTTTCTCTGACACAAAACGACTTGTGGCCATTTTTCAACCTTGTTGTTGGCCATCGCCGAAAGCTG
GTGAAGCGGATAAAGATGAAGGAGGCGGAGAAGTGGCCTGACCATGTCAAGGGAATCGGCCTGGAGCTTGCCTTG
GCCAACAAAATGGACACGAGGAATCCTGGCGAAGGCTGTAAAAAGATGCACGTCAAGGCGTTAAAGGAGGCCCTC
AACAATTCGCCAGTCATCAATTTTGCCTGGGAAGACGTCGACATGCAACCAGAGCCCATGTCGTTTCTCAACGGC
GACGACTCGTCGTTTACCGACGGCTGCCTATCTTGCTGGGAAGAGTACTGCCTTCGCTATCCATGGCCACTGTAC
CGTTTTCCACAAGACGTGATGAGCCGCACTTTGTTTGACGAGAAGAGAGTAACGAGGCGGTTACCCATTTTACGC
ATCGTGGACAAGTTGGTTATTCGCTTTATCCGGCGCAATAATGTGGAGACGCCAGTTGTTCGCTGGGTCTTGGCA
AGCTTGCCTCGTGTTGGGCGCGTGTCTCGGAGCTTTGGACAGAGGACGCCTCGGGCGCAAAAGAATGGGAAGCTG
GTTCGCTGGCGTAGGGGGAGTGTGTAG
Transcript >OphauB2|6421
ATGTCCTGGAACTCGCTACCTCAGGAATTGCAACTCATCATACTCGAATTTGTAGCGGACCGAACCGAACGCGAC
TTTGAGAATCAACTCAAGTTCTCGCCCTTTGCCACGGTTTGCAGTTTCTGGCAATGGTTTTTTGAAACAAAGACG
TTTTGGAGCCTTTCTCTGACACAAAACGACTTGTGGCCATTTTTCAACCTTGTTGTTGGCCATCGCCGAAAGCTG
GTGAAGCGGATAAAGATGAAGGAGGCGGAGAAGTGGCCTGACCATGTCAAGGGAATCGGCCTGGAGCTTGCCTTG
GCCAACAAAATGGACACGAGGAATCCTGGCGAAGGCTGTAAAAAGATGCACGTCAAGGCGTTAAAGGAGGCCCTC
AACAATTCGCCAGTCATCAATTTTGCCTGGGAAGACGTCGACATGCAACCAGAGCCCATGTCGTTTCTCAACGGC
GACGACTCGTCGTTTACCGACGGCTGCCTATCTTGCTGGGAAGAGTACTGCCTTCGCTATCCATGGCCACTGTAC
CGTTTTCCACAAGACGTGATGAGCCGCACTTTGTTTGACGAGAAGAGAGTAACGAGGCGGTTACCCATTTTACGC
ATCGTGGACAAGTTGGTTATTCGCTTTATCCGGCGCAATAATGTGGAGACGCCAGTTGTTCGCTGGGTCTTGGCA
AGCTTGCCTCGTGTTGGGCGCGTGTCTCGGAGCTTTGGACAGAGGACGCCTCGGGCGCAAAAGAATGGGAAGCTG
GTTCGCTGGCGTAGGGGGAGTGTGTAG
Gene >OphauB2|6421
ATGTCCTGGAACTCGCTACCTCAGGAATTGCAACTCATCATACTCGAATTTGTAGCGGACCGAACCGAACGCGAC
TTTGAGAATCAACTCAAGTTCTCGCCCTTTGCCACGGTTTGCAGTTTCTGGCAATGGTTTTTTGAAACAAAGACG
TTTTGGAGCCTTTCTCTGACACAAAACGACTTGTGGCCATTTTTCAACCTTGTTGTTGGCCATCGCCGAAAGCTG
GTGAAGCGGATAAAGATGAAGGTCAGGATTCCATGTCTCTACACGGCACTTGTCGTTGAAGACGTGCAATTCCCG
GGTCTCTTTGAAACAGACTTTATGCTGGCACGGTCGCTACACAGCCTCTTCAAGATACTCTCGTTATAGGAGGCG
GAGAAGTGGCCTGACCATGTCAAGGGAATCGGCCTGGAGCTTGCCTTGGCCAACAAAATGGACACGAGGAATCCT
GGCGAAGGCTGTAAAAAGATGCACGTCAAGGCGTTAAAGGAGGCCCTCAACAATTCGCCAGTCATCAATTTTGCC
TGGGAAGACGTCGACATGCAACCAGAGCCCATGTCGTTTCTCAACGGCGACGACTCGTCGTTTACCGACGGCTGC
CTATCTTGCTGGGAAGAGTACTGCCTTCGCTATCCATGGCCACTGTACCGTTTTCCACAAGACGTGATGAGCCGC
ACTTTGTTTGACGAGAAGAGAGTAACGAGGCGGTTACCCATTTTACGCATCGTGGACAAGTTGGTTATTCGCTTT
ATCCGGCGCAATAATGTGGAGACGCCAGTTGTTCGCTGGGTCTTGGCAAGCTTGCCTCGTGTTGGGCGCGTGTCT
CGGAGCTTTGGACAGAGGACGCCTCGGGCGCAAAAGAATGGGAAGCTGGTTCGCTGGCGTAGGGGGAGTGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail