Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6420
Gene name
LocationContig_59:83908..85279
Strand+
Gene length (bp)1371
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 3.7E-08 6 214

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6420
MAPVFAIIGGGIAGTVQAIHLATRFPWLKIQIYEQRSQILSSTSSINPGRPSFGFHYPDLATAVSCQDNTVKFTK
FLESIGCRHIFANAPQHGIYVLVKRPVSILGETVAPVFGPEKLESVYEQIRRHAIRTYADDDIFARHFGPPEDIC
KRLQRHEYEHLLTPQLVDSVGACYETRERTFNVASICAFLSSYVRGLHNIDVITDAHVTHLEKGNQGPAPSFRIT
WRNSLGREACYSADLLTLACWEHNGIARAQLGVSAAVPTYNRVKVLAIVDVAVTAKSIKITRPIFIASGPFGMMS
PQGYHRTTNGRFMCRVACTLAIHTNLLTVADDEPMPLKLQDLLRGSAGAAERHKLAWPIVQGAKQLFSSLESAEL
VDVRCGVVRIPFGQKKGIIDLSDPESEHHSRTESGCRQIGQGLFINEAMKLIYSVFNAEKILAWTLAELKASSWS
TAGNSC*
Coding >OphauB2|6420
ATGGCTCCCGTTTTCGCCATTATCGGAGGTGGCATAGCAGGCACCGTGCAAGCCATTCATCTAGCAACCCGATTC
CCTTGGCTCAAGATACAAATATATGAGCAGCGAAGCCAAATCCTCAGCAGTACCAGCAGCATCAACCCAGGACGC
CCCTCCTTTGGCTTTCACTATCCCGATTTGGCCACGGCAGTCTCTTGCCAGGACAACACTGTCAAGTTTACAAAA
TTTCTCGAGAGCATTGGGTGTCGACACATATTTGCCAATGCGCCGCAGCACGGTATATACGTCTTGGTTAAGCGG
CCAGTCAGCATTCTAGGCGAAACGGTGGCGCCCGTCTTTGGGCCGGAGAAGCTTGAGTCTGTGTATGAGCAGATT
CGACGCCATGCTATTCGCACATATGCAGATGACGACATCTTTGCCAGACACTTTGGTCCGCCAGAGGATATTTGC
AAAAGGCTTCAGAGGCACGAGTACGAGCATCTGCTTACTCCGCAACTTGTAGACAGCGTTGGAGCGTGTTATGAA
ACGCGGGAAAGGACGTTTAATGTTGCCAGCATCTGCGCCTTTCTCAGCTCCTACGTCAGAGGCTTACACAATATT
GACGTTATTACAGACGCCCACGTCACCCACCTGGAAAAAGGAAATCAGGGACCTGCGCCCTCGTTCCGCATCACG
TGGAGGAATAGCCTTGGCCGAGAAGCCTGCTACTCGGCAGACTTGCTCACCCTGGCTTGCTGGGAGCACAACGGC
ATTGCTCGGGCCCAGCTGGGCGTCTCCGCGGCAGTGCCAACGTACAACCGCGTCAAGGTGCTCGCCATTGTCGAC
GTTGCAGTCACGGCAAAAAGCATCAAGATCACACGTCCCATCTTTATCGCCTCGGGGCCCTTTGGCATGATGTCG
CCCCAAGGCTACCACAGAACGACAAACGGCCGCTTCATGTGTCGAGTCGCCTGCACGCTAGCCATTCACACAAAT
CTCCTCACTGTTGCAGATGATGAGCCCATGCCGCTCAAGTTGCAAGACTTGCTTCGCGGCTCAGCAGGTGCTGCA
GAGAGACACAAGCTGGCATGGCCAATCGTCCAGGGGGCAAAGCAGCTCTTTTCCTCTCTCGAGTCTGCTGAGCTT
GTCGATGTTCGCTGCGGGGTTGTCAGGATACCGTTTGGCCAGAAAAAGGGCATTATAGACTTGAGCGATCCGGAA
AGCGAGCATCATTCCAGGACCGAGTCTGGATGTCGCCAGATTGGACAAGGTTTGTTTATCAATGAAGCCATGAAG
CTAATCTACAGCGTCTTTAACGCCGAAAAGATTTTGGCGTGGACTCTTGCTGAGCTCAAAGCATCATCATGGTCC
ACTGCTGGAAATAGTTGTTGA
Transcript >OphauB2|6420
ATGGCTCCCGTTTTCGCCATTATCGGAGGTGGCATAGCAGGCACCGTGCAAGCCATTCATCTAGCAACCCGATTC
CCTTGGCTCAAGATACAAATATATGAGCAGCGAAGCCAAATCCTCAGCAGTACCAGCAGCATCAACCCAGGACGC
CCCTCCTTTGGCTTTCACTATCCCGATTTGGCCACGGCAGTCTCTTGCCAGGACAACACTGTCAAGTTTACAAAA
TTTCTCGAGAGCATTGGGTGTCGACACATATTTGCCAATGCGCCGCAGCACGGTATATACGTCTTGGTTAAGCGG
CCAGTCAGCATTCTAGGCGAAACGGTGGCGCCCGTCTTTGGGCCGGAGAAGCTTGAGTCTGTGTATGAGCAGATT
CGACGCCATGCTATTCGCACATATGCAGATGACGACATCTTTGCCAGACACTTTGGTCCGCCAGAGGATATTTGC
AAAAGGCTTCAGAGGCACGAGTACGAGCATCTGCTTACTCCGCAACTTGTAGACAGCGTTGGAGCGTGTTATGAA
ACGCGGGAAAGGACGTTTAATGTTGCCAGCATCTGCGCCTTTCTCAGCTCCTACGTCAGAGGCTTACACAATATT
GACGTTATTACAGACGCCCACGTCACCCACCTGGAAAAAGGAAATCAGGGACCTGCGCCCTCGTTCCGCATCACG
TGGAGGAATAGCCTTGGCCGAGAAGCCTGCTACTCGGCAGACTTGCTCACCCTGGCTTGCTGGGAGCACAACGGC
ATTGCTCGGGCCCAGCTGGGCGTCTCCGCGGCAGTGCCAACGTACAACCGCGTCAAGGTGCTCGCCATTGTCGAC
GTTGCAGTCACGGCAAAAAGCATCAAGATCACACGTCCCATCTTTATCGCCTCGGGGCCCTTTGGCATGATGTCG
CCCCAAGGCTACCACAGAACGACAAACGGCCGCTTCATGTGTCGAGTCGCCTGCACGCTAGCCATTCACACAAAT
CTCCTCACTGTTGCAGATGATGAGCCCATGCCGCTCAAGTTGCAAGACTTGCTTCGCGGCTCAGCAGGTGCTGCA
GAGAGACACAAGCTGGCATGGCCAATCGTCCAGGGGGCAAAGCAGCTCTTTTCCTCTCTCGAGTCTGCTGAGCTT
GTCGATGTTCGCTGCGGGGTTGTCAGGATACCGTTTGGCCAGAAAAAGGGCATTATAGACTTGAGCGATCCGGAA
AGCGAGCATCATTCCAGGACCGAGTCTGGATGTCGCCAGATTGGACAAGGTTTGTTTATCAATGAAGCCATGAAG
CTAATCTACAGCGTCTTTAACGCCGAAAAGATTTTGGCGTGGACTCTTGCTGAGCTCAAAGCATCATCATGGTCC
ACTGCTGGAAATAGTTGTTGA
Gene >OphauB2|6420
ATGGCTCCCGTTTTCGCCATTATCGGAGGTGGCATAGCAGGCACCGTGCAAGCCATTCATCTAGCAACCCGATTC
CCTTGGCTCAAGATACAAATATATGAGCAGCGAAGCCAAATCCTCAGCAGTACCAGCAGCATCAACCCAGGACGC
CCCTCCTTTGGCTTTCACTATCCCGATTTGGCCACGGCAGTCTCTTGCCAGGACAACACTGTCAAGTTTACAAAA
TTTCTCGAGAGCATTGGGTGTCGACACATATTTGCCAATGCGCCGCAGCACGGTATATACGTCTTGGTTAAGCGG
CCAGTCAGCATTCTAGGCGAAACGGTGGCGCCCGTCTTTGGGCCGGAGAAGCTTGAGTCTGTGTATGAGCAGATT
CGACGCCATGCTATTCGCACATATGCAGATGACGACATCTTTGCCAGACACTTTGGTCCGCCAGAGGATATTTGC
AAAAGGCTTCAGAGGCACGAGTACGAGCATCTGCTTACTCCGCAACTTGTAGACAGCGTTGGAGCGTGTTATGAA
ACGCGGGAAAGGACGTTTAATGTTGCCAGCATCTGCGCCTTTCTCAGCTCCTACGTCAGAGGCTTACACAATATT
GACGTTATTACAGACGCCCACGTCACCCACCTGGAAAAAGGAAATCAGGGACCTGCGCCCTCGTTCCGCATCACG
TGGAGGAATAGCCTTGGCCGAGAAGCCTGCTACTCGGCAGACTTGCTCACCCTGGCTTGCTGGGAGCACAACGGC
ATTGCTCGGGCCCAGCTGGGCGTCTCCGCGGCAGTGCCAACGTACAACCGCGTCAAGGTGCTCGCCATTGTCGAC
GTTGCAGTCACGGCAAAAAGCATCAAGATCACACGTCCCATCTTTATCGCCTCGGGGCCCTTTGGCATGATGTCG
CCCCAAGGCTACCACAGAACGACAAACGGCCGCTTCATGTGTCGAGTCGCCTGCACGCTAGCCATTCACACAAAT
CTCCTCACTGTTGCAGATGATGAGCCCATGCCGCTCAAGTTGCAAGACTTGCTTCGCGGCTCAGCAGGTGCTGCA
GAGAGACACAAGCTGGCATGGCCAATCGTCCAGGGGGCAAAGCAGCTCTTTTCCTCTCTCGAGTCTGCTGAGCTT
GTCGATGTTCGCTGCGGGGTTGTCAGGATACCGTTTGGCCAGAAAAAGGGCATTATAGACTTGAGCGATCCGGAA
AGCGAGCATCATTCCAGGACCGAGTCTGGATGTCGCCAGATTGGACAAGGTTTGTTTATCAATGAAGCCATGAAG
CTAATCTACAGCGTCTTTAACGCCGAAAAGATTTTGGCGTGGACTCTTGCTGAGCTCAAAGCATCATCATGGTCC
ACTGCTGGAAATAGTTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail