Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6414
Gene name
LocationContig_59:72122..72830
Strand+
Gene length (bp)708
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain 3.0E-15 4 97
PF01479 S4 S4 domain 1.7E-09 109 152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP3 PE=1 SV=1 1 182 2.0E-79
sp|O13835|IMP3_SCHPO U3 small nucleolar ribonucleoprotein protein imp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp3 PE=3 SV=1 2 183 4.0E-74
sp|Q01688|YS4L_PNECA Putative 37S ribosomal protein S4-like (Fragment) OS=Pneumocystis carinii GN=RBP PE=3 SV=1 2 169 1.0E-60
sp|Q9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens GN=IMP3 PE=1 SV=1 1 182 2.0E-57
sp|Q921Y2|IMP3_MOUSE U3 small nucleolar ribonucleoprotein protein IMP3 OS=Mus musculus GN=Imp3 PE=2 SV=1 1 182 2.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP3 PE=1 SV=1 1 182 2.0E-79
sp|O13835|IMP3_SCHPO U3 small nucleolar ribonucleoprotein protein imp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp3 PE=3 SV=1 2 183 4.0E-74
sp|Q01688|YS4L_PNECA Putative 37S ribosomal protein S4-like (Fragment) OS=Pneumocystis carinii GN=RBP PE=3 SV=1 2 169 1.0E-60
sp|Q9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens GN=IMP3 PE=1 SV=1 1 182 2.0E-57
sp|Q921Y2|IMP3_MOUSE U3 small nucleolar ribonucleoprotein protein IMP3 OS=Mus musculus GN=Imp3 PE=2 SV=1 1 182 2.0E-57
sp|Q3T0M3|IMP3_BOVIN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Bos taurus GN=IMP3 PE=2 SV=1 1 182 2.0E-56
sp|O01513|YS4L_CAEEL Putative 40S ribosomal protein S4-like OS=Caenorhabditis elegans GN=C48B6.2 PE=3 SV=1 1 183 2.0E-50
sp|A3DMQ4|RS4_STAMF 30S ribosomal protein S4 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps4 PE=3 SV=1 62 170 2.0E-10
sp|Q9YB58|RS4_AERPE 30S ribosomal protein S4 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps4 PE=3 SV=2 27 168 2.0E-10
sp|A2BK77|RS4_HYPBU 30S ribosomal protein S4 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps4 PE=3 SV=1 28 172 5.0E-10
sp|P39467|RS4_SULAC 30S ribosomal protein S4 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps4 PE=3 SV=3 28 169 1.0E-08
sp|A8A8W3|RS4_IGNH4 30S ribosomal protein S4 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps4 PE=3 SV=1 51 164 7.0E-08
sp|Q5JJF2|RS4_THEKO 30S ribosomal protein S4 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps4 PE=3 SV=1 78 169 1.0E-07
sp|Q96YV8|RS4_SULTO 30S ribosomal protein S4 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps4 PE=3 SV=1 54 169 2.0E-07
sp|A1RWT8|RS4_THEPD 30S ribosomal protein S4 OS=Thermofilum pendens (strain Hrk 5) GN=rps4 PE=3 SV=1 32 168 2.0E-07
sp|A8MDS5|RS4_CALMQ 30S ribosomal protein S4 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps4 PE=3 SV=1 54 168 1.0E-06
sp|Q0W1V5|RS4_METAR 30S ribosomal protein S4 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps4 PE=3 SV=1 64 171 1.0E-06
sp|O28000|RS4_ARCFU 30S ribosomal protein S4 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps4 PE=3 SV=1 55 168 1.0E-06
sp|A3MUS9|RS4_PYRCJ 30S ribosomal protein S4 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps4 PE=3 SV=1 80 159 1.0E-06
sp|Q8ZTV1|RS4_PYRAE 30S ribosomal protein S4 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps4 PE=3 SV=1 80 159 2.0E-06
sp|A1RT03|RS4_PYRIL 30S ribosomal protein S4 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps4 PE=3 SV=1 80 159 5.0E-06
sp|B1Y9B8|RS4_PYRNV 30S ribosomal protein S4 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps4 PE=3 SV=1 80 159 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0019843 rRNA binding Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2354
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4164
Ophiocordyceps australis map64 (Brazil) OphauB2|6414 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05389
Ophiocordyceps camponoti-rufipedis Ophun1|4340
Ophiocordyceps kimflemingae Ophio5|5630
Ophiocordyceps subramaniannii Hirsu2|3245

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6414
MVRKLKYHEQRLLRKTDFITYKSDKDHRDKSVVRRYMIQKPEDYHKYNKLCGSLRQLAHRLSLLPPDNAIRRRHE
TLMLDKLYDMGILSTRSKLSAVERDTSVSAFARRRLPVVMTRLHMAENVQAATKLVEQGHVRVGVETVTDPAFLV
TRATEDFVTWAVGSKVKKNILKYRDKLDDFELL*
Coding >OphauB2|6414
ATGGTGCGCAAGCTCAAATATCATGAGCAGCGGCTCCTGCGAAAAACCGACTTTATAACGTACAAGTCGGACAAG
GATCATCGCGACAAGAGTGTTGTGCGGCGGTATATGATTCAGAAGCCCGAAGATTACCACAAGTATAATAAACTC
TGCGGCTCTCTGCGCCAACTCGCCCACCGCCTCTCTCTCCTCCCGCCCGACAATGCCATTCGGCGACGCCACGAG
ACCCTCATGCTCGACAAGCTGTACGACATGGGCATCCTCTCGACGCGCAGCAAGCTCTCTGCCGTGGAGCGCGAC
ACGAGCGTCAGCGCGTTTGCGCGGCGCCGCCTACCCGTGGTCATGACGCGGCTGCACATGGCTGAGAATGTGCAG
GCGGCCACCAAGCTGGTTGAGCAGGGCCATGTGCGCGTCGGGGTCGAGACGGTTACCGATCCGGCGTTTTTGGTG
ACGCGGGCGACGGAAGATTTTGTCACGTGGGCGGTGGGGAGCAAGGTGAAGAAGAATATCCTCAAGTATAGAGAT
AAGCTGGATGATTTTGAGTTGCTGTAG
Transcript >OphauB2|6414
ATGGTGCGCAAGCTCAAATATCATGAGCAGCGGCTCCTGCGAAAAACCGACTTTATAACGTACAAGTCGGACAAG
GATCATCGCGACAAGAGTGTTGTGCGGCGGTATATGATTCAGAAGCCCGAAGATTACCACAAGTATAATAAACTC
TGCGGCTCTCTGCGCCAACTCGCCCACCGCCTCTCTCTCCTCCCGCCCGACAATGCCATTCGGCGACGCCACGAG
ACCCTCATGCTCGACAAGCTGTACGACATGGGCATCCTCTCGACGCGCAGCAAGCTCTCTGCCGTGGAGCGCGAC
ACGAGCGTCAGCGCGTTTGCGCGGCGCCGCCTACCCGTGGTCATGACGCGGCTGCACATGGCTGAGAATGTGCAG
GCGGCCACCAAGCTGGTTGAGCAGGGCCATGTGCGCGTCGGGGTCGAGACGGTTACCGATCCGGCGTTTTTGGTG
ACGCGGGCGACGGAAGATTTTGTCACGTGGGCGGTGGGGAGCAAGGTGAAGAAGAATATCCTCAAGTATAGAGAT
AAGCTGGATGATTTTGAGTTGCTGTAG
Gene >OphauB2|6414
ATGGTGCGCAAGCTCAAATATCATGAGCAGCGGCTCCTGCGAAAAACCGACTTTATAACGTACAAGTCGGACAAG
GATCATCGCGACAAGAGTGTTGTGCGGCGGTATATGATTCAGAAGCCCGAAGATTACCACAAGTATAATAAACTC
TGCGGCGTGCGTACATGATATCCCCAAACCTCCCATACACCATTGACATGGACACTCGATGAACAAGGATGAATA
AACAAATGAAGAAGTGGAAACCAAGATTTATCGCAAGATGCGGCAAAGAGAGAAGCTCTTGCTAACATTGTAACC
CCCCCCCCCTAGTCTCTGCGCCAACTCGCCCACCGCCTCTCTCTCCTCCCGCCCGACAATGCCATTCGGCGACGC
CACGAGACCCTCATGCTCGACAAGCTGTACGACATGGGCATCCTCTCGACGCGCAGCAAGCTCTCTGCCGTGGAG
CGCGACACGAGCGTCAGCGCGTTTGCGCGGCGCCGCCTACCCGTGGTCATGACGCGGCTGCACATGGCTGAGAAT
GTGCAGGCGGCCACCAAGCTGGTTGAGCAGGGCCATGTGCGCGTCGGGGTCGAGACGGTTACCGATCCGGCGTTT
TTGGTGACGCGGGCGACGGAAGATTTTGTCACGTGGGCGGTGGGGAGCAAGGTGAAGAAGAATATCCTCAAGTAT
AGAGATAAGCTGGATGATTTTGAGTTGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail