Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6414
Gene name
LocationContig_59:72122..72830
Strand+
Gene length (bp)708
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain 3.0E-15 4 97
PF01479 S4 S4 domain 1.7E-09 109 152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP3 PE=1 SV=1 1 182 2.0E-79
sp|O13835|IMP3_SCHPO U3 small nucleolar ribonucleoprotein protein imp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp3 PE=3 SV=1 2 183 4.0E-74
sp|Q01688|YS4L_PNECA Putative 37S ribosomal protein S4-like (Fragment) OS=Pneumocystis carinii GN=RBP PE=3 SV=1 2 169 1.0E-60
sp|Q9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens GN=IMP3 PE=1 SV=1 1 182 2.0E-57
sp|Q921Y2|IMP3_MOUSE U3 small nucleolar ribonucleoprotein protein IMP3 OS=Mus musculus GN=Imp3 PE=2 SV=1 1 182 2.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP3 PE=1 SV=1 1 182 2.0E-79
sp|O13835|IMP3_SCHPO U3 small nucleolar ribonucleoprotein protein imp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp3 PE=3 SV=1 2 183 4.0E-74
sp|Q01688|YS4L_PNECA Putative 37S ribosomal protein S4-like (Fragment) OS=Pneumocystis carinii GN=RBP PE=3 SV=1 2 169 1.0E-60
sp|Q9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens GN=IMP3 PE=1 SV=1 1 182 2.0E-57
sp|Q921Y2|IMP3_MOUSE U3 small nucleolar ribonucleoprotein protein IMP3 OS=Mus musculus GN=Imp3 PE=2 SV=1 1 182 2.0E-57
sp|Q3T0M3|IMP3_BOVIN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Bos taurus GN=IMP3 PE=2 SV=1 1 182 2.0E-56
sp|O01513|YS4L_CAEEL Putative 40S ribosomal protein S4-like OS=Caenorhabditis elegans GN=C48B6.2 PE=3 SV=1 1 183 2.0E-50
sp|A3DMQ4|RS4_STAMF 30S ribosomal protein S4 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps4 PE=3 SV=1 62 170 2.0E-10
sp|Q9YB58|RS4_AERPE 30S ribosomal protein S4 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps4 PE=3 SV=2 27 168 2.0E-10
sp|A2BK77|RS4_HYPBU 30S ribosomal protein S4 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps4 PE=3 SV=1 28 172 5.0E-10
sp|P39467|RS4_SULAC 30S ribosomal protein S4 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps4 PE=3 SV=3 28 169 1.0E-08
sp|A8A8W3|RS4_IGNH4 30S ribosomal protein S4 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps4 PE=3 SV=1 51 164 7.0E-08
sp|Q5JJF2|RS4_THEKO 30S ribosomal protein S4 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps4 PE=3 SV=1 78 169 1.0E-07
sp|Q96YV8|RS4_SULTO 30S ribosomal protein S4 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps4 PE=3 SV=1 54 169 2.0E-07
sp|A1RWT8|RS4_THEPD 30S ribosomal protein S4 OS=Thermofilum pendens (strain Hrk 5) GN=rps4 PE=3 SV=1 32 168 2.0E-07
sp|A8MDS5|RS4_CALMQ 30S ribosomal protein S4 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps4 PE=3 SV=1 54 168 1.0E-06
sp|Q0W1V5|RS4_METAR 30S ribosomal protein S4 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps4 PE=3 SV=1 64 171 1.0E-06
sp|O28000|RS4_ARCFU 30S ribosomal protein S4 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps4 PE=3 SV=1 55 168 1.0E-06
sp|A3MUS9|RS4_PYRCJ 30S ribosomal protein S4 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps4 PE=3 SV=1 80 159 1.0E-06
sp|Q8ZTV1|RS4_PYRAE 30S ribosomal protein S4 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps4 PE=3 SV=1 80 159 2.0E-06
sp|A1RT03|RS4_PYRIL 30S ribosomal protein S4 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps4 PE=3 SV=1 80 159 5.0E-06
sp|B1Y9B8|RS4_PYRNV 30S ribosomal protein S4 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps4 PE=3 SV=1 80 159 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0019843 rRNA binding Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6414
MVRKLKYHEQRLLRKTDFITYKSDKDHRDKSVVRRYMIQKPEDYHKYNKLCGSLRQLAHRLSLLPPDNAIRRRHE
TLMLDKLYDMGILSTRSKLSAVERDTSVSAFARRRLPVVMTRLHMAENVQAATKLVEQGHVRVGVETVTDPAFLV
TRATEDFVTWAVGSKVKKNILKYRDKLDDFELL*
Coding >OphauB2|6414
ATGGTGCGCAAGCTCAAATATCATGAGCAGCGGCTCCTGCGAAAAACCGACTTTATAACGTACAAGTCGGACAAG
GATCATCGCGACAAGAGTGTTGTGCGGCGGTATATGATTCAGAAGCCCGAAGATTACCACAAGTATAATAAACTC
TGCGGCTCTCTGCGCCAACTCGCCCACCGCCTCTCTCTCCTCCCGCCCGACAATGCCATTCGGCGACGCCACGAG
ACCCTCATGCTCGACAAGCTGTACGACATGGGCATCCTCTCGACGCGCAGCAAGCTCTCTGCCGTGGAGCGCGAC
ACGAGCGTCAGCGCGTTTGCGCGGCGCCGCCTACCCGTGGTCATGACGCGGCTGCACATGGCTGAGAATGTGCAG
GCGGCCACCAAGCTGGTTGAGCAGGGCCATGTGCGCGTCGGGGTCGAGACGGTTACCGATCCGGCGTTTTTGGTG
ACGCGGGCGACGGAAGATTTTGTCACGTGGGCGGTGGGGAGCAAGGTGAAGAAGAATATCCTCAAGTATAGAGAT
AAGCTGGATGATTTTGAGTTGCTGTAG
Transcript >OphauB2|6414
ATGGTGCGCAAGCTCAAATATCATGAGCAGCGGCTCCTGCGAAAAACCGACTTTATAACGTACAAGTCGGACAAG
GATCATCGCGACAAGAGTGTTGTGCGGCGGTATATGATTCAGAAGCCCGAAGATTACCACAAGTATAATAAACTC
TGCGGCTCTCTGCGCCAACTCGCCCACCGCCTCTCTCTCCTCCCGCCCGACAATGCCATTCGGCGACGCCACGAG
ACCCTCATGCTCGACAAGCTGTACGACATGGGCATCCTCTCGACGCGCAGCAAGCTCTCTGCCGTGGAGCGCGAC
ACGAGCGTCAGCGCGTTTGCGCGGCGCCGCCTACCCGTGGTCATGACGCGGCTGCACATGGCTGAGAATGTGCAG
GCGGCCACCAAGCTGGTTGAGCAGGGCCATGTGCGCGTCGGGGTCGAGACGGTTACCGATCCGGCGTTTTTGGTG
ACGCGGGCGACGGAAGATTTTGTCACGTGGGCGGTGGGGAGCAAGGTGAAGAAGAATATCCTCAAGTATAGAGAT
AAGCTGGATGATTTTGAGTTGCTGTAG
Gene >OphauB2|6414
ATGGTGCGCAAGCTCAAATATCATGAGCAGCGGCTCCTGCGAAAAACCGACTTTATAACGTACAAGTCGGACAAG
GATCATCGCGACAAGAGTGTTGTGCGGCGGTATATGATTCAGAAGCCCGAAGATTACCACAAGTATAATAAACTC
TGCGGCGTGCGTACATGATATCCCCAAACCTCCCATACACCATTGACATGGACACTCGATGAACAAGGATGAATA
AACAAATGAAGAAGTGGAAACCAAGATTTATCGCAAGATGCGGCAAAGAGAGAAGCTCTTGCTAACATTGTAACC
CCCCCCCCCTAGTCTCTGCGCCAACTCGCCCACCGCCTCTCTCTCCTCCCGCCCGACAATGCCATTCGGCGACGC
CACGAGACCCTCATGCTCGACAAGCTGTACGACATGGGCATCCTCTCGACGCGCAGCAAGCTCTCTGCCGTGGAG
CGCGACACGAGCGTCAGCGCGTTTGCGCGGCGCCGCCTACCCGTGGTCATGACGCGGCTGCACATGGCTGAGAAT
GTGCAGGCGGCCACCAAGCTGGTTGAGCAGGGCCATGTGCGCGTCGGGGTCGAGACGGTTACCGATCCGGCGTTT
TTGGTGACGCGGGCGACGGAAGATTTTGTCACGTGGGCGGTGGGGAGCAAGGTGAAGAAGAATATCCTCAAGTAT
AGAGATAAGCTGGATGATTTTGAGTTGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail