Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6410
Gene name
LocationContig_59:64161..65613
Strand-
Gene length (bp)1452
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 227 461 3.0E-12
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 164 453 4.0E-12
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 261 448 3.0E-07
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 261 448 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 102 120 18
2 135 157 22
3 204 226 22
4 236 255 19
5 264 283 19
6 298 319 21
7 340 362 22
8 377 399 22
9 406 428 22
10 433 455 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6410
MGPGTSNTEAESSLASRRNQGFGTPLLFDAQDDVSNGVDNESSPSKMGPSSDSDDMDNGDGHDDNDANGEHHQPM
LSRRSTMRSRSPLTAVAAAEKNARRKYTYAAFFLAVSLITFTIQTEMSSHIQHDLGWDKAYCMMYFTHGSWIVLW
PAMLLILRLQHLDVPWPIFWRRHTQLLRDTAAMIEMQTLNVSGPATQGRARPLAYLLRTTAFITSALTVAGVSWY
VAVSLTTPSDLTAIYNCSAFFAYVFSVPILREPWRVDKTIAVLIAIVGVLIVAYGDTGGPSSDDADPSKKVPGTG
SRFVGNLVIGIGSVLYGLYEVLYKRYACPPEGVSPFRGTIFANTFGSCIGLFTLTVLWIPLPLLHILGIERFELP
DAATARLILVAVLANATFSGCFLVLISLTSPVLSSVAALLTIFIVALADWVLTGQPLSGAALLGGSMIIVAFLGL
SWSTYREMTEHEARKMAVDLTDSDEDADIAHDG*
Coding >OphauB2|6410
ATGGGCCCTGGAACAAGCAACACTGAAGCAGAGTCGTCGTTGGCATCGCGGCGCAACCAAGGCTTTGGCACGCCG
CTGCTCTTTGACGCCCAAGACGACGTGAGCAATGGCGTCGACAATGAGTCGTCGCCGTCCAAGATGGGGCCGTCA
AGCGACAGCGACGACATGGACAATGGTGACGGCCATGACGACAATGATGCAAATGGCGAGCATCACCAGCCCATG
CTAAGCCGCCGCTCCACGATGCGCAGCCGCAGCCCCCTCACAGCCGTGGCCGCGGCCGAAAAGAATGCTCGCCGC
AAGTACACGTATGCCGCCTTTTTCCTCGCCGTCAGCCTCATCACCTTTACCATCCAGACCGAGATGAGCTCGCAC
ATTCAGCACGACCTGGGCTGGGACAAGGCCTACTGCATGATGTACTTTACCCACGGCTCCTGGATCGTTCTCTGG
CCCGCCATGCTGCTTATTCTCCGCCTCCAGCACCTCGACGTGCCCTGGCCAATCTTTTGGCGCCGCCATACCCAG
CTGCTGCGCGATACCGCTGCCATGATTGAGATGCAGACGCTCAATGTCTCTGGGCCCGCCACCCAAGGCCGCGCC
CGGCCGCTGGCATATTTGCTTCGCACCACGGCCTTTATCACCTCGGCATTGACAGTTGCCGGCGTGAGCTGGTAT
GTTGCTGTCAGCTTGACCACGCCGTCAGACTTGACTGCCATTTACAATTGCTCCGCCTTTTTTGCCTACGTCTTC
TCCGTGCCTATTCTGAGGGAACCGTGGCGCGTCGACAAGACAATTGCCGTCTTGATTGCCATTGTCGGCGTGCTC
ATTGTGGCTTATGGCGACACGGGCGGCCCCTCGTCTGACGACGCCGATCCCTCCAAGAAGGTGCCCGGCACTGGC
AGTCGCTTTGTCGGAAACCTCGTCATTGGCATCGGCTCCGTTCTATATGGTCTCTACGAGGTGCTATACAAACGC
TATGCCTGCCCCCCTGAAGGCGTCTCTCCCTTTCGCGGCACCATTTTCGCAAATACTTTTGGCTCTTGCATCGGC
CTCTTTACCCTCACCGTTCTCTGGATCCCCTTGCCTCTGTTGCACATCCTTGGCATTGAGCGTTTTGAGCTGCCC
GATGCTGCCACGGCGCGCCTCATTCTCGTGGCTGTGCTCGCAAATGCCACGTTTAGCGGCTGCTTCCTCGTGCTT
ATTTCCCTCACTTCGCCCGTGCTTTCGTCCGTGGCCGCTCTTCTCACAATCTTCATCGTCGCATTGGCCGACTGG
GTCCTCACGGGCCAGCCCCTCAGCGGTGCTGCTCTCTTGGGCGGGTCCATGATTATAGTGGCCTTTCTCGGACTT
AGCTGGAGCACCTATCGCGAAATGACGGAGCACGAGGCACGCAAAATGGCTGTCGACTTGACTGACAGCGACGAG
GATGCGGATATTGCCCACGACGGCTGA
Transcript >OphauB2|6410
ATGGGCCCTGGAACAAGCAACACTGAAGCAGAGTCGTCGTTGGCATCGCGGCGCAACCAAGGCTTTGGCACGCCG
CTGCTCTTTGACGCCCAAGACGACGTGAGCAATGGCGTCGACAATGAGTCGTCGCCGTCCAAGATGGGGCCGTCA
AGCGACAGCGACGACATGGACAATGGTGACGGCCATGACGACAATGATGCAAATGGCGAGCATCACCAGCCCATG
CTAAGCCGCCGCTCCACGATGCGCAGCCGCAGCCCCCTCACAGCCGTGGCCGCGGCCGAAAAGAATGCTCGCCGC
AAGTACACGTATGCCGCCTTTTTCCTCGCCGTCAGCCTCATCACCTTTACCATCCAGACCGAGATGAGCTCGCAC
ATTCAGCACGACCTGGGCTGGGACAAGGCCTACTGCATGATGTACTTTACCCACGGCTCCTGGATCGTTCTCTGG
CCCGCCATGCTGCTTATTCTCCGCCTCCAGCACCTCGACGTGCCCTGGCCAATCTTTTGGCGCCGCCATACCCAG
CTGCTGCGCGATACCGCTGCCATGATTGAGATGCAGACGCTCAATGTCTCTGGGCCCGCCACCCAAGGCCGCGCC
CGGCCGCTGGCATATTTGCTTCGCACCACGGCCTTTATCACCTCGGCATTGACAGTTGCCGGCGTGAGCTGGTAT
GTTGCTGTCAGCTTGACCACGCCGTCAGACTTGACTGCCATTTACAATTGCTCCGCCTTTTTTGCCTACGTCTTC
TCCGTGCCTATTCTGAGGGAACCGTGGCGCGTCGACAAGACAATTGCCGTCTTGATTGCCATTGTCGGCGTGCTC
ATTGTGGCTTATGGCGACACGGGCGGCCCCTCGTCTGACGACGCCGATCCCTCCAAGAAGGTGCCCGGCACTGGC
AGTCGCTTTGTCGGAAACCTCGTCATTGGCATCGGCTCCGTTCTATATGGTCTCTACGAGGTGCTATACAAACGC
TATGCCTGCCCCCCTGAAGGCGTCTCTCCCTTTCGCGGCACCATTTTCGCAAATACTTTTGGCTCTTGCATCGGC
CTCTTTACCCTCACCGTTCTCTGGATCCCCTTGCCTCTGTTGCACATCCTTGGCATTGAGCGTTTTGAGCTGCCC
GATGCTGCCACGGCGCGCCTCATTCTCGTGGCTGTGCTCGCAAATGCCACGTTTAGCGGCTGCTTCCTCGTGCTT
ATTTCCCTCACTTCGCCCGTGCTTTCGTCCGTGGCCGCTCTTCTCACAATCTTCATCGTCGCATTGGCCGACTGG
GTCCTCACGGGCCAGCCCCTCAGCGGTGCTGCTCTCTTGGGCGGGTCCATGATTATAGTGGCCTTTCTCGGACTT
AGCTGGAGCACCTATCGCGAAATGACGGAGCACGAGGCACGCAAAATGGCTGTCGACTTGACTGACAGCGACGAG
GATGCGGATATTGCCCACGACGGCTGA
Gene >OphauB2|6410
ATGGGCCCTGGAACAAGCAACACTGAAGCAGAGTCGTCGTTGGCATCGCGGCGCAACCAAGGCTTTGGCACGCCG
CTGCTCTTTGACGCCCAAGACGACGTGAGCAATGGCGTCGACAATGAGTCGTCGCCGTCCAAGATGGGGCCGTCA
AGCGACAGCGACGACATGGACAATGGTGACGGCCATGACGACAATGATGCAAATGGCGAGCATCACCAGCCCATG
CTAAGCCGCCGCTCCACGATGCGCAGCCGCAGCCCCCTCACAGCCGTGGCCGCGGCCGAAAAGAATGCTCGCCGC
AAGTACACGTATGCCGCCTTTTTCCTCGCCGTCAGCCTCATCACCTTTACCATCCAGACCGAGATGAGCTCGCAC
ATTCAGCACGACCTGGGCTGGGACAAGGCCTACTGCATGATGTACTTTACCCACGGCTCCTGGATCGTTCTCTGG
CCCGCCATGCTGCTTATTCTCCGCCTCCAGCACCTCGACGTGCCCTGGCCAATCTTTTGGCGCCGCCATACCCAG
CTGCTGCGCGATACCGCTGCCATGATTGAGATGCAGACGCTCAATGTCTCTGGGCCCGCCACCCAAGGCCGCGCC
CGGCCGCTGGCATATTTGCTTCGCACCACGGCCTTTATCACCTCGGCATTGACAGTTGCCGGCGTGAGCTGGTAT
GTTGCTGTCAGCTTGACCACGCCGTCAGACTTGACTGCCATTTACAATTGCTCCGCCTTTTTTGCCTACGTCTTC
TCCGTGCCTATTCTGAGGGAACCGTGGCGCGTCGACAAGACAATTGCCGTCTTGATTGCCATTGTCGGCGTGCTC
ATTGTGGCTTATGGCGACACGGGCGGCCCCTCGTCTGACGACGCCGATCCCTCCAAGAAGGTGCCCGGCACTGGC
AGTCGCTTTGTCGGAAACCTCGTCATTGGCATCGGCTCCGTTCTATATGGTCTCTACGAGGTGCTATACAAACGC
TATGCCTGCCCCCCTGAAGGCGTCTCTCCCTTTCGCGGCACCATTTTCGCAAATACTTTTGGCTCTTGCATCGGC
CTCTTTACCCTCACCGTTCTCTGGATCCCCTTGCCTCTGTTGCACATCCTTGGCATTGAGCGTTTTGAGCTGCCC
GATGCTGCCACGGCGCGCCTCATTCTCGTGGCTGTGCTCGCAAATGCCACGTTTAGCGGCTGCTTCCTCGTGCTT
ATTTCCCTCACTTCGCCCGTGCTTTCGTCCGTGGCCGCTCTTCTCACAATCTTCATCGTCGCATTGGCCGACTGG
GTCCTCACGGGCCAGCCCCTCAGCGGTGCTGCTCTCTTGGGCGGGTCCATGATTATAGTGGCCTTTCTCGGACTT
AGCTGGAGCACCTATCGCGAAATGACGGAGCACGAGGCACGCAAAATGGCTGTCGACTTGACTGACAGCGACGAG
GATGCGGATATTGCCCACGACGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail