Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6404
Gene name
LocationContig_59:51296..52911
Strand+
Gene length (bp)1615
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01761 DHQ_synthase 3-dehydroquinate synthase 4.8E-51 86 334
PF13685 Fe-ADH_2 Iron-containing alcohol dehydrogenase 9.8E-13 46 219

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZAE9|ACBC_ACTS5 2-epi-5-epi-valiolone synthase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbC PE=3 SV=3 9 380 4.0E-69
sp|A2BW03|AROB_PROM5 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=aroB PE=3 SV=1 25 382 9.0E-37
sp|Q8RB14|AROB_CALS4 3-dehydroquinate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=aroB PE=3 SV=1 23 360 2.0E-36
sp|B8I359|AROB_CLOCE 3-dehydroquinate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=aroB PE=3 SV=1 4 366 2.0E-35
sp|A4J3A3|AROB_DESRM 3-dehydroquinate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=aroB PE=3 SV=1 49 381 2.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZAE9|ACBC_ACTS5 2-epi-5-epi-valiolone synthase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbC PE=3 SV=3 9 380 4.0E-69
sp|A2BW03|AROB_PROM5 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=aroB PE=3 SV=1 25 382 9.0E-37
sp|Q8RB14|AROB_CALS4 3-dehydroquinate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=aroB PE=3 SV=1 23 360 2.0E-36
sp|B8I359|AROB_CLOCE 3-dehydroquinate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=aroB PE=3 SV=1 4 366 2.0E-35
sp|A4J3A3|AROB_DESRM 3-dehydroquinate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=aroB PE=3 SV=1 49 381 2.0E-34
sp|P96749|AROB_CORP2 3-dehydroquinate synthase OS=Corynebacterium pseudotuberculosis (strain C231) GN=aroB PE=3 SV=2 109 382 4.0E-34
sp|B0JID6|AROB_MICAN 3-dehydroquinate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=aroB PE=3 SV=1 39 373 4.0E-34
sp|B0K0I7|AROB_THEPX 3-dehydroquinate synthase OS=Thermoanaerobacter sp. (strain X514) GN=aroB PE=3 SV=1 39 359 6.0E-34
sp|B0K924|AROB_THEP3 3-dehydroquinate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=aroB PE=3 SV=1 39 354 6.0E-34
sp|Q7VBT3|AROB_PROMA 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=aroB PE=3 SV=1 86 383 7.0E-34
sp|Q7U6M8|AROB_SYNPX 3-dehydroquinate synthase OS=Synechococcus sp. (strain WH8102) GN=aroB PE=3 SV=1 49 382 9.0E-34
sp|A2BQG2|AROB_PROMS 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain AS9601) GN=aroB PE=3 SV=1 46 375 5.0E-33
sp|B7K660|AROB_CYAP8 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 8801) GN=aroB PE=3 SV=1 36 385 8.0E-33
sp|A8G451|AROB_PROM2 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=aroB PE=3 SV=1 46 375 2.0E-32
sp|A3PC83|AROB_PROM0 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=aroB PE=3 SV=1 46 375 2.0E-32
sp|Q3ZZN1|AROB_DEHMC 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=aroB PE=3 SV=1 50 385 2.0E-32
sp|Q31BK2|AROB_PROM9 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=aroB PE=3 SV=1 46 375 3.0E-32
sp|B2I0J2|AROB_ACIBC 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain ACICU) GN=aroB PE=3 SV=1 40 385 9.0E-32
sp|A5FRZ7|AROB_DEHMB 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=aroB PE=3 SV=1 50 385 9.0E-32
sp|P0CM22|ARO1_CRYNJ Pentafunctional AROM polypeptide OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB01990 PE=3 SV=1 15 329 1.0E-31
sp|P0CM23|ARO1_CRYNB Pentafunctional AROM polypeptide OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBB3730 PE=3 SV=1 15 329 1.0E-31
sp|Q0SV35|AROB_CLOPS 3-dehydroquinate synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=aroB PE=3 SV=1 39 374 2.0E-31
sp|B0VQ34|AROB_ACIBS 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain SDF) GN=aroB PE=3 SV=1 40 385 2.0E-31
sp|B0V8M9|AROB_ACIBY 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AYE) GN=aroB PE=3 SV=1 40 385 2.0E-31
sp|B7IAV6|AROB_ACIB5 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AB0057) GN=aroB PE=3 SV=1 40 385 2.0E-31
sp|B7GVP5|AROB_ACIB3 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=aroB PE=3 SV=1 40 385 2.0E-31
sp|P73997|AROB_SYNY3 3-dehydroquinate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aroB PE=3 SV=1 49 381 2.0E-31
sp|Q21H84|AROB_SACD2 3-dehydroquinate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=aroB PE=3 SV=1 45 362 2.0E-31
sp|Q0TTA0|AROB_CLOP1 3-dehydroquinate synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=aroB PE=3 SV=1 39 356 3.0E-31
sp|Q6NH04|AROB_CORDI 3-dehydroquinate synthase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=aroB PE=3 SV=1 87 355 4.0E-31
sp|B1XKA0|AROB_SYNP2 3-dehydroquinate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=aroB PE=3 SV=1 49 373 4.0E-31
sp|Q7V209|AROB_PROMP 3-dehydroquinate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=aroB PE=3 SV=1 49 377 4.0E-31
sp|Q8FT31|AROB_COREF 3-dehydroquinate synthase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=aroB PE=3 SV=1 87 383 5.0E-31
sp|Q8XMJ3|AROB_CLOPE 3-dehydroquinate synthase OS=Clostridium perfringens (strain 13 / Type A) GN=aroB PE=3 SV=1 39 356 6.0E-31
sp|A3M9I8|AROB_ACIBT 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=aroB PE=3 SV=2 40 385 7.0E-31
sp|Q9A434|AROB_CAUCR 3-dehydroquinate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=aroB PE=3 SV=1 25 327 7.0E-31
sp|B8H332|AROB_CAUCN 3-dehydroquinate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=aroB PE=3 SV=1 25 327 7.0E-31
sp|B7KJH2|AROB_CYAP7 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 7424) GN=aroB PE=3 SV=1 49 390 1.0E-30
sp|Q9X5D2|AROB_CORGL 3-dehydroquinate synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroB PE=3 SV=2 87 383 2.0E-30
sp|A3LSZ2|ARO1_PICST Pentafunctional AROM polypeptide OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARO1 PE=3 SV=2 86 381 2.0E-30
sp|Q48PH0|AROB_PSE14 3-dehydroquinate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=aroB PE=3 SV=1 49 394 2.0E-30
sp|A4QEJ6|AROB_CORGB 3-dehydroquinate synthase OS=Corynebacterium glutamicum (strain R) GN=aroB PE=3 SV=1 87 383 2.0E-30
sp|Q8VYV7|DHQS_ARATH 3-dehydroquinate synthase, chloroplastic OS=Arabidopsis thaliana GN=DHQS PE=1 SV=1 38 386 3.0E-30
sp|A6VDF9|AROB_PSEA7 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=aroB PE=3 SV=1 86 390 4.0E-30
sp|C6HCG7|ARO1_AJECH Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain H143) GN=HCDG_03716 PE=3 SV=1 15 327 6.0E-30
sp|C5JKE6|ARO1_AJEDS Pentafunctional AROM polypeptide OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02999 PE=3 SV=1 15 327 6.0E-30
sp|C5G8R4|ARO1_AJEDR Pentafunctional AROM polypeptide OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_01028 PE=3 SV=1 15 327 7.0E-30
sp|Q980I9|AROB_SULSO 3-dehydroquinate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aroB PE=3 SV=1 86 363 7.0E-30
sp|Q87V15|AROB_PSESM 3-dehydroquinate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=aroB PE=3 SV=1 49 394 7.0E-30
sp|B8GPV3|AROB_THISH 3-dehydroquinate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=aroB PE=3 SV=1 47 382 1.0E-29
sp|A6TL07|AROB_ALKMQ 3-dehydroquinate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=aroB PE=3 SV=1 50 359 1.0E-29
sp|Q9CCS4|AROB_MYCLE 3-dehydroquinate synthase OS=Mycobacterium leprae (strain TN) GN=aroB PE=3 SV=1 40 355 1.0E-29
sp|A1AQL5|AROB_PELPD 3-dehydroquinate synthase OS=Pelobacter propionicus (strain DSM 2379) GN=aroB PE=3 SV=1 62 370 1.0E-29
sp|Q02EX9|AROB_PSEAB 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=aroB PE=3 SV=1 86 381 2.0E-29
sp|C4Y9D5|ARO1_CLAL4 Pentafunctional AROM polypeptide OS=Clavispora lusitaniae (strain ATCC 42720) GN=ARO1 PE=3 SV=1 86 381 2.0E-29
sp|Q96Y96|AROB_SULTO 3-dehydroquinate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aroB PE=3 SV=1 86 363 2.0E-29
sp|C0NL63|ARO1_AJECG Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_03893 PE=3 SV=1 15 327 2.0E-29
sp|B7V3D1|AROB_PSEA8 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=aroB PE=3 SV=1 86 381 2.0E-29
sp|A5EXS0|AROB_DICNV 3-dehydroquinate synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=aroB PE=3 SV=1 86 393 2.0E-29
sp|C1F548|AROB_ACIC5 3-dehydroquinate synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=aroB PE=3 SV=1 23 381 2.0E-29
sp|A6R8Q8|ARO1_AJECN Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06699 PE=3 SV=1 15 327 3.0E-29
sp|Q6F7E5|AROB_ACIAD 3-dehydroquinate synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=aroB PE=3 SV=1 45 329 3.0E-29
sp|Q8DCM0|AROB_VIBVU 3-dehydroquinate synthase OS=Vibrio vulnificus (strain CMCP6) GN=aroB PE=3 SV=1 49 382 3.0E-29
sp|P59487|AROB_BUCBP 3-dehydroquinate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aroB PE=3 SV=1 59 370 3.0E-29
sp|Q7MH84|AROB_VIBVY 3-dehydroquinate synthase OS=Vibrio vulnificus (strain YJ016) GN=aroB PE=3 SV=1 49 382 3.0E-29
sp|Q3M4V2|AROB_ANAVT 3-dehydroquinate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=aroB PE=3 SV=1 49 381 4.0E-29
sp|C3KAI3|AROB_PSEFS 3-dehydroquinate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=aroB PE=3 SV=1 62 390 4.0E-29
sp|Q3AJM8|AROB_SYNSC 3-dehydroquinate synthase OS=Synechococcus sp. (strain CC9605) GN=aroB PE=3 SV=1 49 385 5.0E-29
sp|Q0AJ12|AROB_NITEC 3-dehydroquinate synthase OS=Nitrosomonas eutropha (strain C91) GN=aroB PE=3 SV=1 49 353 5.0E-29
sp|B1WUD4|AROB_CYAA5 3-dehydroquinate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=aroB PE=3 SV=1 49 385 6.0E-29
sp|Q38X86|AROB_LACSS 3-dehydroquinate synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=aroB PE=3 SV=1 24 370 9.0E-29
sp|A5D374|AROB_PELTS 3-dehydroquinate synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=aroB PE=3 SV=1 39 327 9.0E-29
sp|A7MSY2|AROB_VIBCB 3-dehydroquinate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=aroB PE=3 SV=1 49 387 1.0E-28
sp|P9WPX9|AROB_MYCTU 3-dehydroquinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aroB PE=1 SV=1 65 358 1.0E-28
sp|P9WPX8|AROB_MYCTO 3-dehydroquinate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aroB PE=3 SV=1 65 358 1.0E-28
sp|P0A4Z5|AROB_MYCBO 3-dehydroquinate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aroB PE=3 SV=1 65 358 1.0E-28
sp|Q4JVG2|AROB_CORJK 3-dehydroquinate synthase OS=Corynebacterium jeikeium (strain K411) GN=aroB PE=3 SV=1 66 358 1.0E-28
sp|Q7V7S1|AROB_PROMM 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=aroB PE=3 SV=1 50 381 1.0E-28
sp|A7F7H0|ARO1_SCLS1 Pentafunctional AROM polypeptide OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13550 PE=3 SV=1 4 327 1.0E-28
sp|B6QWH9|ARO11_TALMQ Pentafunctional AROM polypeptide 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=aroM-1 PE=3 SV=1 54 366 2.0E-28
sp|A1R703|AROB_ARTAT 3-dehydroquinate synthase OS=Arthrobacter aurescens (strain TC1) GN=aroB PE=3 SV=1 103 331 2.0E-28
sp|Q5XNP0|ARO1_SCLSC Pentafunctional AROM polypeptide OS=Sclerotinia sclerotiorum PE=3 SV=1 4 327 2.0E-28
sp|A2C1E0|AROB_PROM1 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain NATL1A) GN=aroB PE=3 SV=1 86 381 2.0E-28
sp|P34002|AROB_PSEAE 3-dehydroquinate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aroB PE=3 SV=2 86 381 2.0E-28
sp|Q3Z988|AROB_DEHM1 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=aroB PE=3 SV=1 50 385 2.0E-28
sp|C5M1X2|ARO1_CANTT Pentafunctional AROM polypeptide OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=ARO1 PE=3 SV=1 86 381 4.0E-28
sp|A4TBX8|AROB_MYCGI 3-dehydroquinate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=aroB PE=3 SV=1 49 358 4.0E-28
sp|Q8YVQ0|AROB_NOSS1 3-dehydroquinate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aroB PE=3 SV=1 49 381 5.0E-28
sp|B8H8V5|AROB_ARTCA 3-dehydroquinate synthase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=aroB PE=3 SV=1 39 331 5.0E-28
sp|Q5AME2|ARO1_CANAL Pentafunctional AROM polypeptide OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARO1 PE=3 SV=1 86 381 5.0E-28
sp|B7VLJ6|AROB_VIBTL 3-dehydroquinate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=aroB PE=3 SV=1 49 387 5.0E-28
sp|Q9KNV2|AROB_VIBCH 3-dehydroquinate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aroB PE=1 SV=2 46 382 6.0E-28
sp|Q46LM0|AROB_PROMT 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=aroB PE=3 SV=1 86 381 6.0E-28
sp|B6QCA7|ARO12_TALMQ Pentafunctional AROM polypeptide 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=aroM-2 PE=3 SV=1 54 366 6.0E-28
sp|Q5N3D4|AROB_SYNP6 3-dehydroquinate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=aroB PE=3 SV=1 25 383 7.0E-28
sp|B9WFG1|ARO1_CANDC Pentafunctional AROM polypeptide OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ARO1 PE=3 SV=1 86 381 8.0E-28
sp|A5UAU8|AROB_HAEIE 3-dehydroquinate synthase OS=Haemophilus influenzae (strain PittEE) GN=aroB PE=3 SV=1 86 371 8.0E-28
sp|B0T8F3|AROB_CAUSK 3-dehydroquinate synthase OS=Caulobacter sp. (strain K31) GN=aroB PE=3 SV=1 25 309 1.0E-27
sp|A5UG10|AROB_HAEIG 3-dehydroquinate synthase OS=Haemophilus influenzae (strain PittGG) GN=aroB PE=3 SV=1 86 371 1.0E-27
sp|Q827R8|AROB_STRAW 3-dehydroquinate synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=aroB PE=3 SV=1 39 355 1.0E-27
sp|A5N6A8|AROB_CLOK5 3-dehydroquinate synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=aroB PE=3 SV=1 25 366 1.0E-27
sp|Q5HUF4|AROB_CAMJR 3-dehydroquinate synthase OS=Campylobacter jejuni (strain RM1221) GN=aroB PE=3 SV=1 86 381 2.0E-27
sp|Q9PNT2|AROB_CAMJE 3-dehydroquinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=aroB PE=3 SV=1 86 381 2.0E-27
sp|Q0D0F3|ARO1_ASPTN Pentafunctional AROM polypeptide OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aroM PE=3 SV=1 15 365 2.0E-27
sp|C9SE96|ARO1_VERA1 Pentafunctional AROM polypeptide OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_03429 PE=3 SV=1 54 327 2.0E-27
sp|B8M0U4|ARO1_TALSN Pentafunctional AROM polypeptide OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=aroM PE=3 SV=1 54 366 2.0E-27
sp|A7H333|AROB_CAMJD 3-dehydroquinate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=aroB PE=3 SV=1 77 381 2.0E-27
sp|C0S433|ARO1_PARBP Pentafunctional AROM polypeptide OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02447 PE=3 SV=1 15 323 2.0E-27
sp|A8QCB2|ARO1_MALGO Pentafunctional AROM polypeptide OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_3989 PE=3 SV=1 54 320 2.0E-27
sp|P43879|AROB_HAEIN 3-dehydroquinate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aroB PE=3 SV=1 86 371 2.0E-27
sp|B5ZA49|AROB_HELPG 3-dehydroquinate synthase OS=Helicobacter pylori (strain G27) GN=aroB PE=3 SV=1 86 335 2.0E-27
sp|C1FYJ9|ARO1_PARBD Pentafunctional AROM polypeptide OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00875 PE=3 SV=2 15 323 2.0E-27
sp|Q8RU74|DHQS_SOLLC 3-dehydroquinate synthase, chloroplastic OS=Solanum lycopersicum GN=DHQS PE=2 SV=1 49 383 2.0E-27
sp|Q9ZMF2|AROB_HELPJ 3-dehydroquinate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=aroB PE=3 SV=1 86 335 2.0E-27
sp|A9BA66|AROB_PROM4 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=aroB PE=3 SV=1 45 382 2.0E-27
sp|A2C9Z1|AROB_PROM3 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=aroB PE=3 SV=1 50 381 2.0E-27
sp|C1H8L1|ARO1_PARBA Pentafunctional AROM polypeptide OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_07102 PE=3 SV=2 15 323 3.0E-27
sp|Q4JC76|AROB_SULAC 3-dehydroquinate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=aroB PE=3 SV=1 86 363 3.0E-27
sp|B6J3I1|AROB_COXB2 3-dehydroquinate synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=aroB PE=3 SV=1 41 329 3.0E-27
sp|A2RMH5|AROB_LACLM 3-dehydroquinate synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=aroB PE=3 SV=1 46 381 3.0E-27
sp|Q9CES8|AROB_LACLA 3-dehydroquinate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=aroB PE=3 SV=1 46 381 4.0E-27
sp|Q88CV2|AROB_PSEPK 3-dehydroquinate synthase OS=Pseudomonas putida (strain KT2440) GN=aroB PE=3 SV=1 62 383 4.0E-27
sp|Q1Q8Q9|AROB_PSYCK 3-dehydroquinate synthase OS=Psychrobacter cryohalolentis (strain K5) GN=aroB PE=3 SV=1 45 384 4.0E-27
sp|A5H2Q8|ARO11_LODEL Pentafunctional AROM polypeptide 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ARO1-1 PE=3 SV=1 36 329 4.0E-27
sp|Q4ZZE3|AROB_PSEU2 3-dehydroquinate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aroB PE=3 SV=1 49 394 5.0E-27
sp|B2J913|AROB_NOSP7 3-dehydroquinate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=aroB PE=3 SV=1 49 359 5.0E-27
sp|B3R7B8|AROB_CUPTR 3-dehydroquinate synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=aroB PE=3 SV=1 38 327 5.0E-27
sp|D1ZA70|ARO1_SORMK Pentafunctional AROM polypeptide OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_02366 PE=3 SV=1 52 320 6.0E-27
sp|B3H035|AROB_ACTP7 3-dehydroquinate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aroB PE=3 SV=1 75 327 6.0E-27
sp|A3MYR5|AROB_ACTP2 3-dehydroquinate synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aroB PE=3 SV=1 75 327 6.0E-27
sp|A6VKZ5|AROB_ACTSZ 3-dehydroquinate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=aroB PE=3 SV=1 50 327 6.0E-27
sp|Q741J7|AROB_MYCPA 3-dehydroquinate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=aroB PE=3 SV=1 52 358 6.0E-27
sp|A5H2P4|ARO12_LODEL Pentafunctional AROM polypeptide 2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ARO1-2 PE=3 SV=1 36 329 7.0E-27
sp|Q2UCP6|ARO1_ASPOR Pentafunctional AROM polypeptide OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aroM PE=3 SV=1 15 365 7.0E-27
sp|B8N4Q9|ARO1_ASPFN Pentafunctional AROM polypeptide OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aroM PE=3 SV=1 15 365 7.0E-27
sp|Q82TB9|AROB_NITEU 3-dehydroquinate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=aroB PE=3 SV=1 49 353 8.0E-27
sp|Q74BL6|AROB_GEOSL 3-dehydroquinate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=aroB PE=3 SV=1 49 336 8.0E-27
sp|Q47QY7|AROB_THEFY 3-dehydroquinate synthase OS=Thermobifida fusca (strain YX) GN=aroB PE=3 SV=1 86 358 9.0E-27
sp|A1VZZ6|AROB_CAMJJ 3-dehydroquinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=aroB PE=3 SV=1 86 381 9.0E-27
sp|Q46WJ4|AROB_CUPPJ 3-dehydroquinate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=aroB PE=3 SV=1 36 329 1.0E-26
sp|Q8J294|ARO1_THACU Pentafunctional AROM polypeptide OS=Thanatephorus cucumeris PE=3 SV=1 81 327 1.0E-26
sp|P57924|AROB_PASMU 3-dehydroquinate synthase OS=Pasteurella multocida (strain Pm70) GN=aroB PE=3 SV=1 86 327 1.0E-26
sp|B5YHI4|AROB_THEYD 3-dehydroquinate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=aroB PE=3 SV=1 45 382 1.0E-26
sp|B2USB4|AROB_HELPS 3-dehydroquinate synthase OS=Helicobacter pylori (strain Shi470) GN=aroB PE=3 SV=1 86 359 1.0E-26
sp|B8HRK7|AROB_CYAP4 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=aroB PE=3 SV=1 49 361 1.0E-26
sp|A5WAB1|AROB_PSEP1 3-dehydroquinate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=aroB PE=3 SV=1 62 383 1.0E-26
sp|B6JKL2|AROB_HELP2 3-dehydroquinate synthase OS=Helicobacter pylori (strain P12) GN=aroB PE=3 SV=1 86 335 1.0E-26
sp|B6HAA7|ARO1_PENRW Pentafunctional AROM polypeptide OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=aroM PE=3 SV=1 54 384 1.0E-26
sp|A3DDJ2|AROB_CLOTH 3-dehydroquinate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=aroB PE=3 SV=1 38 367 1.0E-26
sp|P56081|AROB_HELPY 3-dehydroquinate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=aroB PE=1 SV=1 86 335 1.0E-26
sp|P07547|ARO1_EMENI Pentafunctional AROM polypeptide OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aromA PE=1 SV=3 15 327 1.0E-26
sp|B0UTE6|AROB_HISS2 3-dehydroquinate synthase OS=Histophilus somni (strain 2336) GN=aroB PE=3 SV=1 86 327 2.0E-26
sp|Q8U0A8|AROB_PYRFU 3-dehydroquinate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=aroB PE=3 SV=1 86 361 2.0E-26
sp|A1AW10|AROB_RUTMC 3-dehydroquinate synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=aroB PE=3 SV=1 36 329 2.0E-26
sp|Q6C1X5|ARO1_YARLI Pentafunctional AROM polypeptide OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARO1 PE=3 SV=1 17 320 2.0E-26
sp|C5DN02|ARO1_LACTC Pentafunctional AROM polypeptide OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=ARO1 PE=3 SV=1 86 366 2.0E-26
sp|Q83AJ2|AROB_COXBU 3-dehydroquinate synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=aroB PE=3 SV=1 41 329 2.0E-26
sp|A9NB81|AROB_COXBR 3-dehydroquinate synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=aroB PE=3 SV=1 41 329 2.0E-26
sp|B6J4A4|AROB_COXB1 3-dehydroquinate synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=aroB PE=3 SV=1 41 329 2.0E-26
sp|Q4WS76|ARO1_ASPFU Pentafunctional AROM polypeptide OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aroM PE=3 SV=1 15 365 2.0E-26
sp|Q2S2D3|AROB_SALRD 3-dehydroquinate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=aroB PE=3 SV=1 50 376 2.0E-26
sp|B0XRM8|ARO1_ASPFC Pentafunctional AROM polypeptide OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aroM PE=3 SV=1 15 365 2.0E-26
sp|Q02XB8|AROB_LACLS 3-dehydroquinate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=aroB PE=3 SV=1 46 381 2.0E-26
sp|Q4QNY2|AROB_HAEI8 3-dehydroquinate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=aroB PE=3 SV=1 86 371 2.0E-26
sp|A1D244|ARO1_NEOFI Pentafunctional AROM polypeptide OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aroM PE=3 SV=1 15 365 2.0E-26
sp|B1J2J5|AROB_PSEPW 3-dehydroquinate synthase OS=Pseudomonas putida (strain W619) GN=aroB PE=3 SV=1 62 383 2.0E-26
sp|A8FM57|AROB_CAMJ8 3-dehydroquinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=aroB PE=3 SV=1 86 381 2.0E-26
sp|Q8XV62|AROB_RALSO 3-dehydroquinate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=aroB PE=3 SV=1 36 327 2.0E-26
sp|F2MTI0|AROB_ENTFO 3-dehydroquinate synthase OS=Enterococcus faecalis (strain ATCC 47077 / OG1RF) GN=aroB PE=3 SV=1 25 382 3.0E-26
sp|A1CP85|ARO1_ASPCL Pentafunctional AROM polypeptide OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aroM PE=3 SV=1 8 365 3.0E-26
sp|B7N1G6|AROB_ECO81 3-dehydroquinate synthase OS=Escherichia coli O81 (strain ED1a) GN=aroB PE=3 SV=1 49 330 3.0E-26
sp|A8NMB4|ARO1_COPC7 Pentafunctional AROM polypeptide OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_09809 PE=3 SV=2 54 349 3.0E-26
sp|C5PA86|ARO1_COCP7 Pentafunctional AROM polypeptide OS=Coccidioides posadasii (strain C735) GN=CPC735_008210 PE=3 SV=1 10 327 4.0E-26
sp|Q5P5P3|AROB_AROAE 3-dehydroquinate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=aroB PE=3 SV=1 25 355 4.0E-26
sp|A1T8F5|AROB_MYCVP 3-dehydroquinate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=aroB PE=3 SV=1 49 358 4.0E-26
sp|Q4P8F6|ARO1_USTMA Pentafunctional AROM polypeptide OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_03607 PE=3 SV=1 49 320 4.0E-26
sp|Q0K669|AROB_CUPNH 3-dehydroquinate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=aroB PE=3 SV=1 86 329 4.0E-26
sp|Q87L68|AROB_VIBPA 3-dehydroquinate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aroB PE=3 SV=1 49 382 4.0E-26
sp|U3KRF2|DHQS_ACTCH 3-dehydroquinate synthase, chloroplastic OS=Actinidia chinensis GN=DHQS PE=1 SV=2 41 383 4.0E-26
sp|B4RG33|AROB_PHEZH 3-dehydroquinate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=aroB PE=3 SV=1 39 327 4.0E-26
sp|C4R4R8|ARO1_PICPG Pentafunctional AROM polypeptide OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ARO1 PE=3 SV=1 86 366 5.0E-26
sp|B5ZSI4|AROB_RHILW 3-dehydroquinate synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=aroB PE=3 SV=1 25 377 5.0E-26
sp|Q0I432|AROB_HAES1 3-dehydroquinate synthase OS=Haemophilus somnus (strain 129Pt) GN=aroB PE=3 SV=1 86 327 5.0E-26
sp|Q9P7R0|ARO1_SCHPO Pentafunctional AROM polypeptide OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aro1 PE=3 SV=1 52 320 6.0E-26
sp|Q8X071|ARO1_NEUCR Pentafunctional AROM polypeptide OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aro-1 PE=3 SV=1 52 320 6.0E-26
sp|A8GKQ7|AROB_SERP5 3-dehydroquinate synthase OS=Serratia proteamaculans (strain 568) GN=aroB PE=3 SV=1 49 337 7.0E-26
sp|B5EP40|AROB_ACIF5 3-dehydroquinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=aroB PE=3 SV=1 54 327 8.0E-26
sp|B7J629|AROB_ACIF2 3-dehydroquinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=aroB PE=3 SV=1 54 327 8.0E-26
sp|Q07VC9|AROB_RHOP5 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=aroB PE=3 SV=1 50 387 8.0E-26
sp|C5BRJ7|AROB_TERTT 3-dehydroquinate synthase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=aroB PE=3 SV=1 49 355 8.0E-26
sp|Q5ZX00|AROB_LEGPH 3-dehydroquinate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=aroB PE=3 SV=1 40 381 8.0E-26
sp|Q0V3H0|ARO1_PHANO Pentafunctional AROM polypeptide OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_01444 PE=3 SV=2 86 332 9.0E-26
sp|B9KG40|AROB_CAMLR 3-dehydroquinate synthase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=aroB PE=3 SV=1 77 383 9.0E-26
sp|B0CBS9|AROB_ACAM1 3-dehydroquinate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=aroB PE=3 SV=1 49 381 1.0E-25
sp|Q1IGA7|AROB_PSEE4 3-dehydroquinate synthase OS=Pseudomonas entomophila (strain L48) GN=aroB PE=3 SV=1 62 383 1.0E-25
sp|Q92ME7|AROB_RHIME 3-dehydroquinate synthase OS=Rhizobium meliloti (strain 1021) GN=aroB PE=3 SV=1 25 377 1.0E-25
sp|A1SRB7|AROB_PSYIN 3-dehydroquinate synthase OS=Psychromonas ingrahamii (strain 37) GN=aroB PE=3 SV=1 36 383 1.0E-25
sp|Q60BY2|AROB_METCA 3-dehydroquinate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=aroB PE=3 SV=1 86 383 1.0E-25
sp|A3CNV7|AROB_STRSV 3-dehydroquinate synthase OS=Streptococcus sanguinis (strain SK36) GN=aroB PE=3 SV=1 25 355 1.0E-25
sp|P0DH71|AROB_ENTFA 3-dehydroquinate synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=aroB PE=3 SV=1 25 382 1.0E-25
sp|Q3IJA2|AROB_PSEHT 3-dehydroquinate synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aroB PE=3 SV=1 86 382 1.0E-25
sp|Q3JEG3|AROB_NITOC 3-dehydroquinate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=aroB PE=3 SV=1 86 382 1.0E-25
sp|Q1MB46|AROB_RHIL3 3-dehydroquinate synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=aroB PE=3 SV=1 25 377 1.0E-25
sp|Q9KXQ6|AROB_STRCO 3-dehydroquinate synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=aroB PE=3 SV=1 46 355 1.0E-25
sp|B0D6H2|ARO1_LACBS Pentafunctional AROM polypeptide OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_233717 PE=3 SV=1 86 320 2.0E-25
sp|A4RD09|ARO1_MAGO7 Pentafunctional AROM polypeptide OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_01128 PE=3 SV=2 86 329 2.0E-25
sp|B8CNI9|AROB_SHEPW 3-dehydroquinate synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=aroB PE=3 SV=1 24 382 2.0E-25
sp|A7GYE1|AROB_CAMC5 3-dehydroquinate synthase OS=Campylobacter curvus (strain 525.92) GN=aroB PE=3 SV=1 86 385 2.0E-25
sp|Q39X04|AROB_GEOMG 3-dehydroquinate synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=aroB PE=3 SV=1 86 334 2.0E-25
sp|Q1LI88|AROB_CUPMC 3-dehydroquinate synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=aroB PE=3 SV=1 86 327 2.0E-25
sp|Q5NPY8|AROB_ZYMMO 3-dehydroquinate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=aroB PE=3 SV=1 45 327 3.0E-25
sp|Q8U9V0|AROB_AGRFC 3-dehydroquinate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=aroB PE=3 SV=1 25 381 3.0E-25
sp|Q5X6H0|AROB_LEGPA 3-dehydroquinate synthase OS=Legionella pneumophila (strain Paris) GN=aroB PE=3 SV=1 49 374 3.0E-25
sp|Q3KJA1|AROB_PSEPF 3-dehydroquinate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=aroB PE=3 SV=1 62 390 3.0E-25
sp|Q6AF95|AROB_LEIXX 3-dehydroquinate synthase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=aroB PE=3 SV=1 87 391 3.0E-25
sp|B4TY46|AROB_SALSV 3-dehydroquinate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=aroB PE=3 SV=1 50 361 4.0E-25
sp|Q4KJI8|AROB_PSEF5 3-dehydroquinate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=aroB PE=3 SV=1 62 390 4.0E-25
sp|Q2K3L3|AROB_RHIEC 3-dehydroquinate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=aroB PE=3 SV=1 25 377 4.0E-25
sp|C4LB07|AROB_TOLAT 3-dehydroquinate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=aroB PE=3 SV=1 49 383 4.0E-25
sp|Q6CJC4|ARO1_KLULA Pentafunctional AROM polypeptide OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARO1 PE=3 SV=1 86 366 4.0E-25
sp|A9KBB1|AROB_COXBN 3-dehydroquinate synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=aroB PE=3 SV=1 41 329 4.0E-25
sp|A5IFX9|AROB_LEGPC 3-dehydroquinate synthase OS=Legionella pneumophila (strain Corby) GN=aroB PE=3 SV=1 86 374 5.0E-25
sp|Q1CUM0|AROB_HELPH 3-dehydroquinate synthase OS=Helicobacter pylori (strain HPAG1) GN=aroB PE=3 SV=1 86 335 5.0E-25
sp|C5FQ73|ARO1_ARTOC Pentafunctional AROM polypeptide OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04845 PE=3 SV=1 78 365 5.0E-25
sp|B3PPF1|AROB_RHIE6 3-dehydroquinate synthase OS=Rhizobium etli (strain CIAT 652) GN=aroB PE=3 SV=1 25 377 5.0E-25
sp|Q39KC4|AROB_BURL3 3-dehydroquinate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=aroB PE=3 SV=1 36 318 5.0E-25
sp|B5FBN1|AROB_VIBFM 3-dehydroquinate synthase OS=Vibrio fischeri (strain MJ11) GN=aroB PE=3 SV=1 49 385 6.0E-25
sp|Q5E2G0|AROB_VIBF1 3-dehydroquinate synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=aroB PE=3 SV=1 49 385 6.0E-25
sp|A8AQU3|AROB_CITK8 3-dehydroquinate synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aroB PE=3 SV=1 50 329 6.0E-25
sp|C7YZ74|ARO1_NECH7 Pentafunctional AROM polypeptide OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_47780 PE=3 SV=1 86 366 6.0E-25
sp|Q63Q57|AROB_BURPS 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain K96243) GN=aroB PE=3 SV=1 54 327 7.0E-25
sp|A3NED2|AROB_BURP6 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 668) GN=aroB PE=3 SV=1 54 327 7.0E-25
sp|Q3JMW1|AROB_BURP1 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=aroB PE=3 SV=1 54 327 7.0E-25
sp|A3P066|AROB_BURP0 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=aroB PE=3 SV=1 54 327 7.0E-25
sp|A1V8D7|AROB_BURMS 3-dehydroquinate synthase OS=Burkholderia mallei (strain SAVP1) GN=aroB PE=3 SV=1 54 327 7.0E-25
sp|Q62GB0|AROB_BURMA 3-dehydroquinate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=aroB PE=3 SV=1 54 327 7.0E-25
sp|A2S718|AROB_BURM9 3-dehydroquinate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=aroB PE=3 SV=1 54 327 7.0E-25
sp|A3MPY1|AROB_BURM7 3-dehydroquinate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=aroB PE=3 SV=1 54 327 7.0E-25
sp|C1CEW4|AROB_STRZJ 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain JJA) GN=aroB PE=3 SV=1 25 381 8.0E-25
sp|Q32AK1|AROB_SHIDS 3-dehydroquinate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=aroB PE=3 SV=1 49 330 8.0E-25
sp|B2UEG9|AROB_RALPJ 3-dehydroquinate synthase OS=Ralstonia pickettii (strain 12J) GN=aroB PE=3 SV=1 36 327 9.0E-25
sp|Q31DP9|AROB_THICR 3-dehydroquinate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=aroB PE=3 SV=1 36 329 9.0E-25
sp|B5E8I9|AROB_GEOBB 3-dehydroquinate synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=aroB PE=3 SV=1 54 354 9.0E-25
sp|A8GZ30|AROB_SHEPA 3-dehydroquinate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=aroB PE=3 SV=1 45 373 9.0E-25
sp|Q4FQI3|AROB_PSYA2 3-dehydroquinate synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=aroB PE=3 SV=1 45 384 1.0E-24
sp|A6Q908|AROB_SULNB 3-dehydroquinate synthase OS=Sulfurovum sp. (strain NBC37-1) GN=aroB PE=3 SV=1 61 327 1.0E-24
sp|A5GF05|AROB_GEOUR 3-dehydroquinate synthase OS=Geobacter uraniireducens (strain Rf4) GN=aroB PE=3 SV=1 78 355 1.0E-24
sp|Q2YB61|AROB_NITMU 3-dehydroquinate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=aroB PE=3 SV=1 40 329 1.0E-24
sp|A6W2T3|AROB_MARMS 3-dehydroquinate synthase OS=Marinomonas sp. (strain MWYL1) GN=aroB PE=3 SV=1 49 386 2.0E-24
sp|B4E603|AROB_BURCJ 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=aroB PE=3 SV=1 36 318 2.0E-24
sp|B0TL76|AROB_SHEHH 3-dehydroquinate synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=aroB PE=3 SV=1 45 373 2.0E-24
sp|B5R7M8|AROB_SALG2 3-dehydroquinate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aroB PE=3 SV=1 50 361 2.0E-24
sp|B5R2D5|AROB_SALEP 3-dehydroquinate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=aroB PE=3 SV=1 50 361 2.0E-24
sp|B1JIQ4|AROB_YERPY 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aroB PE=3 SV=1 50 329 2.0E-24
sp|Q664M0|AROB_YERPS 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aroB PE=3 SV=1 50 329 2.0E-24
sp|A4TGU2|AROB_YERPP 3-dehydroquinate synthase OS=Yersinia pestis (strain Pestoides F) GN=aroB PE=3 SV=1 50 329 2.0E-24
sp|Q1CCP0|AROB_YERPN 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aroB PE=3 SV=1 50 329 2.0E-24
sp|A9R4A9|AROB_YERPG 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aroB PE=3 SV=1 50 329 2.0E-24
sp|Q8ZJF6|AROB_YERPE 3-dehydroquinate synthase OS=Yersinia pestis GN=aroB PE=3 SV=1 50 329 2.0E-24
sp|B2K5T4|AROB_YERPB 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aroB PE=3 SV=1 50 329 2.0E-24
sp|Q1C2P3|AROB_YERPA 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aroB PE=3 SV=1 50 329 2.0E-24
sp|A7FNT5|AROB_YERP3 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aroB PE=3 SV=1 50 329 2.0E-24
sp|Q5WXX5|AROB_LEGPL 3-dehydroquinate synthase OS=Legionella pneumophila (strain Lens) GN=aroB PE=3 SV=1 49 374 2.0E-24
sp|B1YRS4|AROB_BURA4 3-dehydroquinate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=aroB PE=3 SV=1 54 318 3.0E-24
sp|B5XTU7|AROB_KLEP3 3-dehydroquinate synthase OS=Klebsiella pneumoniae (strain 342) GN=aroB PE=3 SV=1 50 333 3.0E-24
sp|Q9V1H9|AROB_PYRAB 3-dehydroquinate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aroB PE=3 SV=2 86 360 3.0E-24
sp|Q7VNR5|AROB_HAEDU 3-dehydroquinate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=aroB PE=3 SV=1 86 382 3.0E-24
sp|A6Q3Y3|AROB_NITSB 3-dehydroquinate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=aroB PE=3 SV=1 86 381 3.0E-24
sp|A4VH14|AROB_PSEU5 3-dehydroquinate synthase OS=Pseudomonas stutzeri (strain A1501) GN=aroB PE=3 SV=1 86 391 3.0E-24
sp|Q8KCK9|AROB_CHLTE 3-dehydroquinate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=aroB PE=3 SV=1 39 324 3.0E-24
sp|P77980|AROB_SALTY 3-dehydroquinate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroB PE=3 SV=1 50 361 3.0E-24
sp|Q8Z205|AROB_SALTI 3-dehydroquinate synthase OS=Salmonella typhi GN=aroB PE=3 SV=1 50 361 3.0E-24
sp|Q98FY1|AROB_RHILO 3-dehydroquinate synthase OS=Rhizobium loti (strain MAFF303099) GN=aroB PE=3 SV=1 50 377 3.0E-24
sp|Q1R5P8|AROB_ECOUT 3-dehydroquinate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=aroB PE=3 SV=1 49 330 3.0E-24
sp|B1LHI4|AROB_ECOSM 3-dehydroquinate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aroB PE=3 SV=1 49 330 3.0E-24
sp|B7NDZ3|AROB_ECOLU 3-dehydroquinate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aroB PE=3 SV=1 49 330 3.0E-24
sp|B1IP76|AROB_ECOLC 3-dehydroquinate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aroB PE=3 SV=1 49 330 3.0E-24
sp|Q8FCV7|AROB_ECOL6 3-dehydroquinate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroB PE=3 SV=1 49 330 3.0E-24
sp|A1AGR6|AROB_ECOK1 3-dehydroquinate synthase OS=Escherichia coli O1:K1 / APEC GN=aroB PE=3 SV=1 49 330 3.0E-24
sp|B7NMF2|AROB_ECO7I 3-dehydroquinate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aroB PE=3 SV=1 49 330 3.0E-24
sp|B7MD00|AROB_ECO45 3-dehydroquinate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aroB PE=3 SV=1 49 330 3.0E-24
sp|B7UK94|AROB_ECO27 3-dehydroquinate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aroB PE=3 SV=1 49 330 3.0E-24
sp|A8A5J6|AROB_ECOHS 3-dehydroquinate synthase OS=Escherichia coli O9:H4 (strain HS) GN=aroB PE=3 SV=1 49 330 4.0E-24
sp|B5YTT8|AROB_ECO5E 3-dehydroquinate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aroB PE=3 SV=1 49 330 4.0E-24
sp|Q8X824|AROB_ECO57 3-dehydroquinate synthase OS=Escherichia coli O157:H7 GN=aroB PE=3 SV=1 49 330 4.0E-24
sp|B5BH29|AROB_SALPK 3-dehydroquinate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=aroB PE=3 SV=1 50 361 4.0E-24
sp|C0Q0G1|AROB_SALPC 3-dehydroquinate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=aroB PE=3 SV=1 50 361 4.0E-24
sp|A9MT55|AROB_SALPB 3-dehydroquinate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aroB PE=3 SV=1 50 361 4.0E-24
sp|Q5PLX2|AROB_SALPA 3-dehydroquinate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aroB PE=3 SV=1 50 361 4.0E-24
sp|B4SVI8|AROB_SALNS 3-dehydroquinate synthase OS=Salmonella newport (strain SL254) GN=aroB PE=3 SV=1 50 361 4.0E-24
sp|B4TKR2|AROB_SALHS 3-dehydroquinate synthase OS=Salmonella heidelberg (strain SL476) GN=aroB PE=3 SV=1 50 361 4.0E-24
sp|B5FJQ9|AROB_SALDC 3-dehydroquinate synthase OS=Salmonella dublin (strain CT_02021853) GN=aroB PE=3 SV=1 50 361 4.0E-24
sp|Q57IY8|AROB_SALCH 3-dehydroquinate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=aroB PE=3 SV=1 50 361 4.0E-24
sp|B5F8K0|AROB_SALA4 3-dehydroquinate synthase OS=Salmonella agona (strain SL483) GN=aroB PE=3 SV=1 50 361 4.0E-24
sp|A4VVS9|AROB_STRSY 3-dehydroquinate synthase OS=Streptococcus suis (strain 05ZYH33) GN=aroB PE=3 SV=1 36 366 5.0E-24
sp|A4W236|AROB_STRS2 3-dehydroquinate synthase OS=Streptococcus suis (strain 98HAH33) GN=aroB PE=3 SV=1 36 366 5.0E-24
sp|A1RVE1|AROB_PYRIL 3-dehydroquinate synthase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=aroB PE=3 SV=1 86 362 5.0E-24
sp|B2B223|ARO1_PODAN Pentafunctional AROM polypeptide OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_5280 PE=3 SV=1 54 320 5.0E-24
sp|A6UCL4|AROB_SINMW 3-dehydroquinate synthase OS=Sinorhizobium medicae (strain WSM419) GN=aroB PE=3 SV=1 1 382 5.0E-24
sp|C0ZZB6|AROB_RHOE4 3-dehydroquinate synthase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=aroB PE=3 SV=1 100 321 5.0E-24
sp|P57604|AROB_BUCAI 3-dehydroquinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=aroB PE=3 SV=1 86 361 5.0E-24
sp|B1KP72|AROB_SHEWM 3-dehydroquinate synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=aroB PE=3 SV=1 49 373 5.0E-24
sp|Q3YWN4|AROB_SHISS 3-dehydroquinate synthase OS=Shigella sonnei (strain Ss046) GN=aroB PE=3 SV=1 49 330 5.0E-24
sp|Q31VP5|AROB_SHIBS 3-dehydroquinate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=aroB PE=3 SV=1 49 330 5.0E-24
sp|B6I2U7|AROB_ECOSE 3-dehydroquinate synthase OS=Escherichia coli (strain SE11) GN=aroB PE=3 SV=1 49 330 5.0E-24
sp|B7M1U1|AROB_ECO8A 3-dehydroquinate synthase OS=Escherichia coli O8 (strain IAI1) GN=aroB PE=3 SV=1 49 330 5.0E-24
sp|B7L4R5|AROB_ECO55 3-dehydroquinate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=aroB PE=3 SV=1 49 330 5.0E-24
sp|A7ZSR4|AROB_ECO24 3-dehydroquinate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aroB PE=3 SV=1 49 330 5.0E-24
sp|Q6LVF5|AROB_PHOPR 3-dehydroquinate synthase OS=Photobacterium profundum GN=aroB PE=3 SV=1 41 383 5.0E-24
sp|B5YE18|AROB_DICT6 3-dehydroquinate synthase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=aroB PE=3 SV=1 85 383 6.0E-24
sp|P07639|AROB_ECOLI 3-dehydroquinate synthase OS=Escherichia coli (strain K12) GN=aroB PE=1 SV=1 49 330 6.0E-24
sp|B1X736|AROB_ECODH 3-dehydroquinate synthase OS=Escherichia coli (strain K12 / DH10B) GN=aroB PE=3 SV=1 49 330 6.0E-24
sp|C4ZUP4|AROB_ECOBW 3-dehydroquinate synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aroB PE=3 SV=1 49 330 6.0E-24
sp|Q0TC78|AROB_ECOL5 3-dehydroquinate synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aroB PE=3 SV=1 49 330 6.0E-24
sp|B3LGE9|ARO1_YEAS1 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ARO1 PE=3 SV=1 86 366 6.0E-24
sp|A6TF13|AROB_KLEP7 3-dehydroquinate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aroB PE=3 SV=1 50 333 6.0E-24
sp|Q74ZZ1|ARO1_ASHGO Pentafunctional AROM polypeptide OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARO1 PE=3 SV=2 86 366 6.0E-24
sp|A1WZA9|AROB_HALHL 3-dehydroquinate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=aroB PE=3 SV=1 25 355 6.0E-24
sp|Q6A8I2|AROB_PROAC 3-dehydroquinate synthase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=aroB PE=3 SV=1 74 350 6.0E-24
sp|Q0SZS9|AROB_SHIF8 3-dehydroquinate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=aroB PE=3 SV=1 49 330 6.0E-24
sp|C6E0S2|AROB_GEOSM 3-dehydroquinate synthase OS=Geobacter sp. (strain M21) GN=aroB PE=3 SV=1 54 354 6.0E-24
sp|Q83PX0|AROB_SHIFL 3-dehydroquinate synthase OS=Shigella flexneri GN=aroB PE=3 SV=1 49 330 7.0E-24
sp|C7GIN5|ARO1_YEAS2 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain JAY291) GN=ARO1 PE=3 SV=1 86 366 7.0E-24
sp|B8ZKM4|AROB_STRPJ 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=aroB PE=3 SV=1 25 355 8.0E-24
sp|A9M1U4|AROB_NEIM0 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=aroB PE=3 SV=1 49 314 8.0E-24
sp|Q9JVW5|AROB_NEIMA 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aroB PE=3 SV=1 49 314 8.0E-24
sp|P08566|ARO1_YEAST Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO1 PE=1 SV=1 86 366 8.0E-24
sp|C5BGQ4|AROB_EDWI9 3-dehydroquinate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=aroB PE=3 SV=1 34 330 8.0E-24
sp|B7LS90|AROB_ESCF3 3-dehydroquinate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aroB PE=3 SV=1 49 330 9.0E-24
sp|A6ZY89|ARO1_YEAS7 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain YJM789) GN=ARO1 PE=3 SV=1 86 366 1.0E-23
sp|C8Z543|ARO1_YEAS8 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ARO1 PE=3 SV=1 86 366 1.0E-23
sp|C4JYG6|ARO1_UNCRE Pentafunctional AROM polypeptide OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07217 PE=3 SV=1 10 327 1.0E-23
sp|Q21BX8|AROB_RHOPB 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=aroB PE=3 SV=1 50 372 1.0E-23
sp|A9ADP0|AROB_BURM1 3-dehydroquinate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=aroB PE=3 SV=1 62 318 1.0E-23
sp|A4FBE8|AROB_SACEN 3-dehydroquinate synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=aroB PE=3 SV=1 78 322 1.0E-23
sp|Q3J2J0|AROB_RHOS4 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=aroB PE=3 SV=1 25 372 1.0E-23
sp|A0K3S0|AROB_BURCH 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=aroB PE=3 SV=1 36 318 1.0E-23
sp|Q1BRZ3|AROB_BURCA 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=aroB PE=3 SV=1 36 318 1.0E-23
sp|Q6NCG9|AROB_RHOPA 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=aroB PE=3 SV=1 50 327 2.0E-23
sp|B1JU67|AROB_BURCC 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=aroB PE=3 SV=1 36 318 2.0E-23
sp|A3PJS2|AROB_RHOS1 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=aroB PE=3 SV=1 25 372 2.0E-23
sp|B1YD64|AROB_PYRNV 3-dehydroquinate synthase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=aroB PE=3 SV=1 86 362 2.0E-23
sp|Q0BJ01|AROB_BURCM 3-dehydroquinate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=aroB PE=3 SV=1 54 318 2.0E-23
sp|Q7NA56|AROB_PHOLL 3-dehydroquinate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aroB PE=3 SV=1 86 372 2.0E-23
sp|B3QMM2|AROB_CHLP8 3-dehydroquinate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=aroB PE=3 SV=1 39 390 2.0E-23
sp|Q87DU9|AROB_XYLFT 3-dehydroquinate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=aroB PE=3 SV=1 76 341 2.0E-23
sp|B2I9G0|AROB_XYLF2 3-dehydroquinate synthase OS=Xylella fastidiosa (strain M23) GN=aroB PE=3 SV=1 76 341 2.0E-23
sp|A0Q706|AROB_FRATN 3-dehydroquinate synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=aroB PE=3 SV=1 30 330 2.0E-23
sp|B3QAH7|AROB_RHOPT 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=aroB PE=3 SV=1 50 327 3.0E-23
sp|B2U3J5|AROB_SHIB3 3-dehydroquinate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aroB PE=3 SV=1 49 330 3.0E-23
sp|Q489N3|AROB_COLP3 3-dehydroquinate synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=aroB PE=3 SV=1 86 381 3.0E-23
sp|Q5LSX9|AROB_RUEPO 3-dehydroquinate synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=aroB PE=3 SV=1 25 374 3.0E-23
sp|C1DHQ5|AROB_AZOVD 3-dehydroquinate synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=aroB PE=3 SV=1 49 327 3.0E-23
sp|B4F0B1|AROB_PROMH 3-dehydroquinate synthase OS=Proteus mirabilis (strain HI4320) GN=aroB PE=3 SV=1 46 383 3.0E-23
sp|Q8K939|AROB_BUCAP 3-dehydroquinate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=aroB PE=3 SV=1 50 361 3.0E-23
sp|Q9PDP5|AROB_XYLFA 3-dehydroquinate synthase OS=Xylella fastidiosa (strain 9a5c) GN=aroB PE=3 SV=1 47 341 4.0E-23
sp|A4JAT5|AROB_BURVG 3-dehydroquinate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=aroB PE=3 SV=1 54 318 4.0E-23
sp|A4XPQ2|AROB_PSEMY 3-dehydroquinate synthase OS=Pseudomonas mendocina (strain ymp) GN=aroB PE=3 SV=1 49 381 4.0E-23
sp|Q3A2N6|AROB_PELCD 3-dehydroquinate synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=aroB PE=3 SV=1 49 355 4.0E-23
sp|Q7VHT1|AROB_HELHP 3-dehydroquinate synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=aroB PE=3 SV=1 86 383 4.0E-23
sp|A7ZD95|AROB_CAMC1 3-dehydroquinate synthase OS=Campylobacter concisus (strain 13826) GN=aroB PE=3 SV=1 86 385 5.0E-23
sp|Q5YTK6|AROB_NOCFA 3-dehydroquinate synthase OS=Nocardia farcinica (strain IFM 10152) GN=aroB PE=3 SV=1 102 358 5.0E-23
sp|Q3SLY4|AROB_THIDA 3-dehydroquinate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=aroB PE=3 SV=1 49 327 5.0E-23
sp|C1B4I1|AROB_RHOOB 3-dehydroquinate synthase OS=Rhodococcus opacus (strain B4) GN=aroB PE=3 SV=1 100 322 6.0E-23
sp|Q8P6X3|AROB_XANCP 3-dehydroquinate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=aroB PE=3 SV=1 86 327 6.0E-23
sp|Q4UX86|AROB_XANC8 3-dehydroquinate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=aroB PE=3 SV=2 86 327 6.0E-23
sp|A9MMD9|AROB_SALAR 3-dehydroquinate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=aroB PE=3 SV=1 50 361 7.0E-23
sp|A1KS84|AROB_NEIMF 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=aroB PE=3 SV=1 49 314 7.0E-23
sp|Q9JY01|AROB_NEIMB 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aroB PE=3 SV=1 49 314 7.0E-23
sp|B2SGC9|AROB_FRATM 3-dehydroquinate synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=aroB PE=3 SV=1 30 330 7.0E-23
sp|C1CL84|AROB_STRZP 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain P1031) GN=aroB PE=3 SV=1 25 381 7.0E-23
sp|C1C7X6|AROB_STRP7 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain 70585) GN=aroB PE=3 SV=1 25 381 7.0E-23
sp|Q2A418|AROB_FRATH 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=aroB PE=3 SV=1 30 330 8.0E-23
sp|A7NBH0|AROB_FRATF 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=aroB PE=3 SV=1 30 330 8.0E-23
sp|B0U6C7|AROB_XYLFM 3-dehydroquinate synthase OS=Xylella fastidiosa (strain M12) GN=aroB PE=3 SV=1 76 327 8.0E-23
sp|A7MKL4|AROB_CROS8 3-dehydroquinate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aroB PE=3 SV=1 50 337 8.0E-23
sp|Q65R35|AROB_MANSM 3-dehydroquinate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=aroB PE=3 SV=1 86 327 8.0E-23
sp|B6JVD0|ARO1_SCHJY Pentafunctional AROM polypeptide OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=aro1 PE=3 SV=1 86 320 8.0E-23
sp|B4RQ17|AROB_NEIG2 3-dehydroquinate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=aroB PE=3 SV=1 49 232 9.0E-23
sp|Q5FAD4|AROB_NEIG1 3-dehydroquinate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=aroB PE=3 SV=1 49 232 9.0E-23
sp|Q5JFX1|AROB_THEKO 3-dehydroquinate synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aroB PE=3 SV=1 86 340 9.0E-23
sp|A4WFH7|AROB_ENT38 3-dehydroquinate synthase OS=Enterobacter sp. (strain 638) GN=aroB PE=3 SV=1 50 329 9.0E-23
sp|C1CQY0|AROB_STRZT 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=aroB PE=3 SV=1 25 355 9.0E-23
sp|Q8DPD1|AROB_STRR6 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=aroB PE=3 SV=1 25 355 9.0E-23
sp|Q04JX2|AROB_STRP2 3-dehydroquinate synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=aroB PE=3 SV=1 25 355 9.0E-23
sp|Q97KM3|AROB_CLOAB 3-dehydroquinate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=aroB PE=3 SV=1 32 381 1.0E-22
sp|Q5NFS1|AROB_FRATT 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=aroB PE=3 SV=1 30 330 1.0E-22
sp|Q14H73|AROB_FRAT1 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=aroB PE=3 SV=1 30 330 1.0E-22
sp|A0JX82|AROB_ARTS2 3-dehydroquinate synthase OS=Arthrobacter sp. (strain FB24) GN=aroB PE=3 SV=1 122 331 1.0E-22
sp|C6DGD4|AROB_PECCP 3-dehydroquinate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aroB PE=3 SV=1 49 365 1.0E-22
sp|Q2NQJ2|AROB_SODGM 3-dehydroquinate synthase OS=Sodalis glossinidius (strain morsitans) GN=aroB PE=3 SV=1 62 361 1.0E-22
sp|Q8DUW2|AROB_STRMU 3-dehydroquinate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=aroB PE=3 SV=1 39 382 1.0E-22
sp|A0RP96|AROB_CAMFF 3-dehydroquinate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=aroB PE=3 SV=1 86 374 2.0E-22
sp|B9KSJ9|AROB_RHOSK 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=aroB PE=3 SV=1 25 372 2.0E-22
sp|Q97Q56|AROB_STRPN 3-dehydroquinate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=aroB PE=3 SV=1 25 355 2.0E-22
sp|C5D3E0|AROB_GEOSW 3-dehydroquinate synthase OS=Geobacillus sp. (strain WCH70) GN=aroB PE=3 SV=1 24 201 2.0E-22
sp|Q6MF52|AROB_PARUW 3-dehydroquinate synthase OS=Protochlamydia amoebophila (strain UWE25) GN=aroB PE=3 SV=1 48 372 2.0E-22
sp|Q0HDV7|AROB_SHESM 3-dehydroquinate synthase OS=Shewanella sp. (strain MR-4) GN=aroB PE=3 SV=1 49 338 2.0E-22
sp|Q30RT3|AROB_SULDN 3-dehydroquinate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=aroB PE=3 SV=1 77 382 2.0E-22
sp|Q7M8N9|AROB_WOLSU 3-dehydroquinate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=aroB PE=3 SV=1 77 383 2.0E-22
sp|Q8G5X4|AROKB_BIFLO Bifunctional shikimate kinase/3-dehydroquinate synthase OS=Bifidobacterium longum (strain NCC 2705) GN=aroB PE=3 SV=1 11 371 2.0E-22
sp|A8AXZ4|AROB_STRGC 3-dehydroquinate synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=aroB PE=3 SV=1 25 355 2.0E-22
sp|A5ETC5|AROB_BRASB 3-dehydroquinate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=aroB PE=3 SV=1 25 383 2.0E-22
sp|Q088S6|AROB_SHEFN 3-dehydroquinate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aroB PE=3 SV=1 45 374 2.0E-22
sp|A4WSQ8|AROB_RHOS5 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=aroB PE=3 SV=1 25 355 3.0E-22
sp|Q2P6C9|AROB_XANOM 3-dehydroquinate synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=aroB PE=3 SV=1 86 314 3.0E-22
sp|B8E259|AROB_DICTD 3-dehydroquinate synthase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=aroB PE=3 SV=1 85 381 3.0E-22
sp|B2IQJ3|AROB_STRPS 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=aroB PE=3 SV=1 25 355 3.0E-22
sp|B1ICH6|AROB_STRPI 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=aroB PE=3 SV=1 25 355 3.0E-22
sp|B1ZQS6|AROB_OPITP 3-dehydroquinate synthase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=aroB PE=3 SV=1 86 379 3.0E-22
sp|Q83HU4|AROB_TROW8 3-dehydroquinate synthase OS=Tropheryma whipplei (strain TW08/27) GN=aroB PE=3 SV=1 109 391 3.0E-22
sp|A8G195|AROB_SHESH 3-dehydroquinate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=aroB PE=3 SV=1 45 359 3.0E-22
sp|O50468|AROB_NEIGO 3-dehydroquinate synthase OS=Neisseria gonorrhoeae GN=aroB PE=3 SV=1 49 232 3.0E-22
sp|Q8DKS3|AROB_THEEB 3-dehydroquinate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=aroB PE=3 SV=2 51 304 3.0E-22
sp|B5E5N3|AROB_STRP4 3-dehydroquinate synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=aroB PE=3 SV=1 25 355 3.0E-22
sp|B1GZJ4|AROB_UNCTG 3-dehydroquinate synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=aroB PE=3 SV=1 46 367 3.0E-22
sp|Q5H3H4|AROB_XANOR 3-dehydroquinate synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=aroB PE=3 SV=1 86 314 3.0E-22
sp|B2SKP5|AROB_XANOP 3-dehydroquinate synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=aroB PE=3 SV=1 86 314 3.0E-22
sp|B9JBT6|AROB_AGRRK 3-dehydroquinate synthase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=aroB PE=3 SV=1 25 377 4.0E-22
sp|Q83GD7|AROB_TROWT 3-dehydroquinate synthase OS=Tropheryma whipplei (strain Twist) GN=aroB PE=3 SV=1 109 391 4.0E-22
sp|A3Q9D8|AROB_SHELP 3-dehydroquinate synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=aroB PE=3 SV=1 45 375 5.0E-22
sp|Q8PI87|AROB_XANAC 3-dehydroquinate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=aroB PE=3 SV=1 36 201 5.0E-22
sp|A0L242|AROB_SHESA 3-dehydroquinate synthase OS=Shewanella sp. (strain ANA-3) GN=aroB PE=3 SV=1 36 367 5.0E-22
sp|Q0I052|AROB_SHESR 3-dehydroquinate synthase OS=Shewanella sp. (strain MR-7) GN=aroB PE=3 SV=1 49 381 5.0E-22
sp|C4K6Q9|AROB_HAMD5 3-dehydroquinate synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=aroB PE=3 SV=1 47 381 5.0E-22
sp|Q3B315|AROB_CHLL7 3-dehydroquinate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=aroB PE=3 SV=1 50 385 6.0E-22
sp|Q88XU0|AROB_LACPL 3-dehydroquinate synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=aroB PE=3 SV=2 49 348 6.0E-22
sp|Q6CZQ9|AROB_PECAS 3-dehydroquinate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aroB PE=3 SV=1 50 365 6.0E-22
sp|P63618|AROB_STAAN 3-dehydroquinate synthase OS=Staphylococcus aureus (strain N315) GN=aroB PE=3 SV=1 60 304 9.0E-22
sp|P63617|AROB_STAAM 3-dehydroquinate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=aroB PE=3 SV=1 60 304 9.0E-22
sp|A5ISZ5|AROB_STAA9 3-dehydroquinate synthase OS=Staphylococcus aureus (strain JH9) GN=aroB PE=3 SV=1 60 304 9.0E-22
sp|A6U1T4|AROB_STAA2 3-dehydroquinate synthase OS=Staphylococcus aureus (strain JH1) GN=aroB PE=3 SV=1 60 304 9.0E-22
sp|A7X2G6|AROB_STAA1 3-dehydroquinate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=aroB PE=3 SV=1 60 304 9.0E-22
sp|A8FEK4|AROB_BACP2 3-dehydroquinate synthase OS=Bacillus pumilus (strain SAFR-032) GN=aroB PE=3 SV=1 48 307 9.0E-22
sp|A4YBT0|AROB_SHEPC 3-dehydroquinate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aroB PE=3 SV=1 49 381 9.0E-22
sp|Q5QV59|AROB_IDILO 3-dehydroquinate synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aroB PE=3 SV=1 75 381 9.0E-22
sp|Q3BQS1|AROB_XANC5 3-dehydroquinate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=aroB PE=3 SV=1 30 201 1.0E-21
sp|Q03LH4|AROB_STRTD 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=aroB PE=3 SV=1 39 382 1.0E-21
sp|Q47JK6|AROB_DECAR 3-dehydroquinate synthase OS=Dechloromonas aromatica (strain RCB) GN=aroB PE=3 SV=1 49 384 1.0E-21
sp|A1KBQ4|AROB_AZOSB 3-dehydroquinate synthase OS=Azoarcus sp. (strain BH72) GN=aroB PE=3 SV=1 36 382 1.0E-21
sp|Q8EK19|AROB_SHEON 3-dehydroquinate synthase OS=Shewanella oneidensis (strain MR-1) GN=aroB PE=3 SV=1 49 367 1.0E-21
sp|A4IYI9|AROB_FRATW 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=aroB PE=3 SV=1 30 330 1.0E-21
sp|Q15Y44|AROB_PSEA6 3-dehydroquinate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aroB PE=3 SV=1 78 382 2.0E-21
sp|A1SB13|AROB_SHEAM 3-dehydroquinate synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=aroB PE=3 SV=1 49 303 2.0E-21
sp|Q7NZU4|AROB_CHRVO 3-dehydroquinate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=aroB PE=3 SV=1 54 382 2.0E-21
sp|Q0BMF4|AROB_FRATO 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=aroB PE=3 SV=1 30 330 2.0E-21
sp|Q8RF47|AROB_FUSNN Bifunctional 3-dehydroquinate synthase/phosphatase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=aroB PE=3 SV=1 86 398 2.0E-21
sp|Q89XW8|AROB_BRADU 3-dehydroquinate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=aroB PE=3 SV=1 25 392 3.0E-21
sp|Q164J6|AROB_ROSDO 3-dehydroquinate synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=aroB PE=3 SV=1 25 382 3.0E-21
sp|A7I291|AROB_CAMHC 3-dehydroquinate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=aroB PE=3 SV=1 86 327 3.0E-21
sp|B3DUF9|AROB_METI4 3-dehydroquinate synthase OS=Methylacidiphilum infernorum (isolate V4) GN=aroB PE=3 SV=1 86 323 3.0E-21
sp|Q1GGQ1|AROB_RUEST 3-dehydroquinate synthase OS=Ruegeria sp. (strain TM1040) GN=aroB PE=3 SV=1 49 355 3.0E-21
sp|A6LEZ7|AROB_PARD8 3-dehydroquinate synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=aroB PE=3 SV=1 86 306 3.0E-21
sp|Q2RMW0|AROB_RHORT 3-dehydroquinate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=aroB PE=3 SV=1 39 383 3.0E-21
sp|A1RPQ6|AROB_SHESW 3-dehydroquinate synthase OS=Shewanella sp. (strain W3-18-1) GN=aroB PE=3 SV=1 49 381 3.0E-21
sp|Q6L738|DOIS_STRKN 2-deoxy-scyllo-inosose synthase OS=Streptomyces kanamyceticus GN=kanC PE=1 SV=1 49 313 4.0E-21
sp|B2VJW7|AROB_ERWT9 3-dehydroquinate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aroB PE=3 SV=1 36 329 4.0E-21
sp|A3DA14|AROB_SHEB5 3-dehydroquinate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aroB PE=3 SV=1 36 381 5.0E-21
sp|C1D4Z4|AROB_LARHH 3-dehydroquinate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=aroB PE=3 SV=1 25 366 5.0E-21
sp|Q01Q15|AROB_SOLUE 3-dehydroquinate synthase OS=Solibacter usitatus (strain Ellin6076) GN=aroB PE=3 SV=1 39 374 5.0E-21
sp|A9IZS4|AROB_BART1 3-dehydroquinate synthase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=aroB PE=3 SV=1 34 230 5.0E-21
sp|Q6GGU4|AROB_STAAR 3-dehydroquinate synthase OS=Staphylococcus aureus (strain MRSA252) GN=aroB PE=1 SV=1 60 304 5.0E-21
sp|B6EM44|AROB_ALISL 3-dehydroquinate synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=aroB PE=3 SV=1 49 318 5.0E-21
sp|Q894C9|AROB_CLOTE 3-dehydroquinate synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=aroB PE=3 SV=1 40 389 6.0E-21
sp|A9L694|AROB_SHEB9 3-dehydroquinate synthase OS=Shewanella baltica (strain OS195) GN=aroB PE=3 SV=1 36 381 7.0E-21
sp|Q0C627|AROB_HYPNA 3-dehydroquinate synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=aroB PE=3 SV=1 36 360 8.0E-21
sp|A3MUK4|AROB_PYRCJ 3-dehydroquinate synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=aroB PE=3 SV=1 86 385 8.0E-21
sp|A5CX62|AROB_VESOH 3-dehydroquinate synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=aroB PE=3 SV=1 39 365 8.0E-21
sp|B8EBF1|AROB_SHEB2 3-dehydroquinate synthase OS=Shewanella baltica (strain OS223) GN=aroB PE=3 SV=1 36 381 1.0E-20
sp|Q2MF70|DOIS_STRLV 2-deoxy-scyllo-inosose synthase OS=Streptomyces lividus GN=livC PE=3 SV=1 49 327 1.0E-20
sp|Q8ZW80|AROB_PYRAE 3-dehydroquinate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=aroB PE=3 SV=1 86 331 1.0E-20
sp|Q5M556|AROB_STRT2 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=aroB PE=3 SV=1 39 382 2.0E-20
sp|Q5M0M0|AROB_STRT1 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=aroB PE=3 SV=1 39 382 2.0E-20
sp|A4IQ88|AROB_GEOTN 3-dehydroquinate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=aroB PE=3 SV=1 86 327 2.0E-20
sp|B1YI19|AROB_EXIS2 3-dehydroquinate synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=aroB PE=3 SV=1 50 382 2.0E-20
sp|A1B1J4|AROB_PARDP 3-dehydroquinate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=aroB PE=3 SV=1 25 355 3.0E-20
sp|A6WTR1|AROB_SHEB8 3-dehydroquinate synthase OS=Shewanella baltica (strain OS185) GN=aroB PE=3 SV=1 36 381 3.0E-20
sp|Q9YEJ9|AROB_AERPE 3-dehydroquinate synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=aroB PE=3 SV=1 66 330 3.0E-20
sp|Q5KXU5|AROB_GEOKA 3-dehydroquinate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=aroB PE=3 SV=1 86 221 3.0E-20
sp|A8Z445|AROB_STAAT 3-dehydroquinate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=aroB PE=3 SV=1 60 304 3.0E-20
sp|A6QH16|AROB_STAAE 3-dehydroquinate synthase OS=Staphylococcus aureus (strain Newman) GN=aroB PE=3 SV=1 60 304 3.0E-20
sp|Q5HFV8|AROB_STAAC 3-dehydroquinate synthase OS=Staphylococcus aureus (strain COL) GN=aroB PE=3 SV=1 60 304 3.0E-20
sp|Q2FGX5|AROB_STAA3 3-dehydroquinate synthase OS=Staphylococcus aureus (strain USA300) GN=aroB PE=3 SV=1 60 304 3.0E-20
sp|Q2YY89|AROB_STAAB 3-dehydroquinate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=aroB PE=3 SV=1 60 305 4.0E-20
sp|Q9S5E2|DOIS_BACCI 2-deoxy-scyllo-inosose synthase OS=Bacillus circulans GN=btrC PE=1 SV=1 86 330 4.0E-20
sp|P0CZ81|AROB_STRPQ 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=aroB PE=3 SV=1 24 327 6.0E-20
sp|P0CZ80|AROB_STRP3 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=aroB PE=3 SV=1 24 327 6.0E-20
sp|Q8NWN4|AROB_STAAW 3-dehydroquinate synthase OS=Staphylococcus aureus (strain MW2) GN=aroB PE=3 SV=1 79 304 6.0E-20
sp|Q6G997|AROB_STAAS 3-dehydroquinate synthase OS=Staphylococcus aureus (strain MSSA476) GN=aroB PE=3 SV=1 79 304 6.0E-20
sp|P31102|AROB_BACSU 3-dehydroquinate synthase OS=Bacillus subtilis (strain 168) GN=aroB PE=3 SV=1 50 201 7.0E-20
sp|Q2FYH0|AROB_STAA8 3-dehydroquinate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=aroB PE=3 SV=1 60 304 7.0E-20
sp|Q5XAW2|AROB_STRP6 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=aroB PE=3 SV=2 24 327 8.0E-20
sp|Q12659|ARO1_PNECA Pentafunctional AROM polypeptide OS=Pneumocystis carinii GN=arom PE=3 SV=1 54 327 8.0E-20
sp|Q48S61|AROB_STRPM 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=aroB PE=3 SV=2 24 327 9.0E-20
sp|Q99YR3|AROB_STRP1 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M1 GN=aroB PE=3 SV=1 24 327 9.0E-20
sp|B9E6K7|AROB_MACCJ 3-dehydroquinate synthase OS=Macrococcus caseolyticus (strain JCSC5402) GN=aroB PE=3 SV=1 45 327 1.0E-19
sp|A0KN28|AROB_AERHH 3-dehydroquinate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=aroB PE=3 SV=1 25 386 1.0E-19
sp|B5XME6|AROB_STRPZ 3-dehydroquinate synthase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=aroB PE=3 SV=1 24 327 1.0E-19
sp|Q8EXX1|AROB_LEPIN 3-dehydroquinate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=aroB PE=3 SV=1 54 385 2.0E-19
sp|Q75FW3|AROB_LEPIC 3-dehydroquinate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=aroB PE=3 SV=1 54 385 2.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6404
MSDMKATVEATEKGFQVCGYEKIEYDFEFLDGVFEVAHGQLAQCYSKWKRCLAVMDLNMYTLYGEQMQRYFDHYG
IELSVHKTMIGEKAKSMETLLGIVDSMNEFGVYRKEPVLVVGGGLVTDVAGFACAAYRRNTNYIRIPTTVIGLID
ASVSIKVAVNYGRYKNRLGAYHAPMHTFLDFGFLRTLPTAQIRNGFAELIKISSCAHKETLDLLDEHCEALIATA
FGRLDEAASPELRSVADRICRAGIYEMLRLETPNLHEIMLDRIIAYGHTWSPLHELVPDPPLRHGHAISIDMAYS
ATLAHRRGLLTANDHGRLLRLFSRAGLAMDHAQFDSPLLERATAAILKTRDGKLRAAVPVSPMGQCVFLNDVTQA
EMSAALDAHKELMAEYARGGEGLDAYVDASDTGYAVHGGPVAVEALAACKGHVSSGLDVGDKLRQNGAVAVSVAA
LVNGNGEA*
Coding >OphauB2|6404
ATGTCGGACATGAAGGCGACGGTGGAGGCGACGGAAAAGGGCTTCCAGGTCTGCGGCTATGAAAAGATTGAGTAC
GACTTTGAGTTTCTCGACGGCGTCTTCGAGGTGGCGCACGGGCAGCTGGCGCAGTGCTACAGCAAGTGGAAGCGA
TGCCTGGCCGTCATGGACCTCAACATGTACACGCTGTACGGCGAGCAGATGCAGCGCTACTTTGACCACTACGGC
ATTGAGCTGAGCGTGCACAAGACCATGATTGGGGAAAAGGCCAAGAGCATGGAGACGCTGCTGGGCATTGTCGAC
TCGATGAATGAGTTTGGCGTTTACCGCAAGGAGCCGGTGCTGGTGGTTGGCGGCGGGCTGGTGACTGATGTAGCG
GGCTTCGCCTGCGCTGCATACCGCCGCAACACAAACTACATTCGCATCCCCACCACGGTGATTGGCCTCATTGAC
GCTTCGGTCTCTATCAAAGTCGCCGTCAACTATGGCCGCTACAAGAACCGGCTGGGCGCCTACCACGCCCCCATG
CACACCTTTCTCGACTTTGGCTTCTTGCGCACGCTGCCCACGGCGCAGATTCGCAATGGCTTCGCCGAGCTCATC
AAGATTTCGTCGTGTGCACACAAGGAGACGCTGGACCTGCTTGACGAGCACTGCGAGGCGCTCATTGCCACGGCC
TTTGGACGGCTGGACGAGGCAGCGTCGCCTGAGCTGCGGAGCGTGGCGGATAGGATTTGCCGGGCGGGCATTTAC
GAGATGCTGAGGCTCGAGACGCCCAATCTGCACGAGATTATGCTTGACCGCATCATTGCCTATGGACATACGTGG
TCGCCGCTGCACGAGCTGGTGCCCGATCCTCCACTGCGCCACGGGCACGCCATCTCGATTGACATGGCCTACTCG
GCCACGCTGGCACACCGCCGCGGCCTGCTCACCGCCAATGACCACGGCCGGCTGCTGCGCCTCTTTTCACGCGCC
GGGCTGGCCATGGACCACGCGCAATTTGACAGCCCGCTGCTGGAGCGCGCCACGGCGGCCATTCTCAAGACGCGC
GACGGCAAGCTGCGGGCAGCGGTGCCGGTGAGCCCCATGGGCCAGTGTGTCTTTCTCAACGACGTGACGCAGGCT
GAGATGAGTGCTGCGCTGGATGCGCACAAGGAGCTCATGGCCGAGTATGCGCGTGGTGGTGAGGGATTGGATGCC
TATGTTGATGCGAGCGATACGGGCTATGCGGTGCACGGCGGGCCCGTGGCGGTGGAGGCGCTGGCGGCTTGCAAG
GGACATGTCTCGAGCGGGCTGGATGTGGGTGACAAGTTGCGGCAGAATGGCGCCGTGGCGGTTAGTGTAGCTGCC
CTTGTCAATGGCAATGGCGAGGCCTGA
Transcript >OphauB2|6404
ATGTCGGACATGAAGGCGACGGTGGAGGCGACGGAAAAGGGCTTCCAGGTCTGCGGCTATGAAAAGATTGAGTAC
GACTTTGAGTTTCTCGACGGCGTCTTCGAGGTGGCGCACGGGCAGCTGGCGCAGTGCTACAGCAAGTGGAAGCGA
TGCCTGGCCGTCATGGACCTCAACATGTACACGCTGTACGGCGAGCAGATGCAGCGCTACTTTGACCACTACGGC
ATTGAGCTGAGCGTGCACAAGACCATGATTGGGGAAAAGGCCAAGAGCATGGAGACGCTGCTGGGCATTGTCGAC
TCGATGAATGAGTTTGGCGTTTACCGCAAGGAGCCGGTGCTGGTGGTTGGCGGCGGGCTGGTGACTGATGTAGCG
GGCTTCGCCTGCGCTGCATACCGCCGCAACACAAACTACATTCGCATCCCCACCACGGTGATTGGCCTCATTGAC
GCTTCGGTCTCTATCAAAGTCGCCGTCAACTATGGCCGCTACAAGAACCGGCTGGGCGCCTACCACGCCCCCATG
CACACCTTTCTCGACTTTGGCTTCTTGCGCACGCTGCCCACGGCGCAGATTCGCAATGGCTTCGCCGAGCTCATC
AAGATTTCGTCGTGTGCACACAAGGAGACGCTGGACCTGCTTGACGAGCACTGCGAGGCGCTCATTGCCACGGCC
TTTGGACGGCTGGACGAGGCAGCGTCGCCTGAGCTGCGGAGCGTGGCGGATAGGATTTGCCGGGCGGGCATTTAC
GAGATGCTGAGGCTCGAGACGCCCAATCTGCACGAGATTATGCTTGACCGCATCATTGCCTATGGACATACGTGG
TCGCCGCTGCACGAGCTGGTGCCCGATCCTCCACTGCGCCACGGGCACGCCATCTCGATTGACATGGCCTACTCG
GCCACGCTGGCACACCGCCGCGGCCTGCTCACCGCCAATGACCACGGCCGGCTGCTGCGCCTCTTTTCACGCGCC
GGGCTGGCCATGGACCACGCGCAATTTGACAGCCCGCTGCTGGAGCGCGCCACGGCGGCCATTCTCAAGACGCGC
GACGGCAAGCTGCGGGCAGCGGTGCCGGTGAGCCCCATGGGCCAGTGTGTCTTTCTCAACGACGTGACGCAGGCT
GAGATGAGTGCTGCGCTGGATGCGCACAAGGAGCTCATGGCCGAGTATGCGCGTGGTGGTGAGGGATTGGATGCC
TATGTTGATGCGAGCGATACGGGCTATGCGGTGCACGGCGGGCCCGTGGCGGTGGAGGCGCTGGCGGCTTGCAAG
GGACATGTCTCGAGCGGGCTGGATGTGGGTGACAAGTTGCGGCAGAATGGCGCCGTGGCGGTTAGTGTAGCTGCC
CTTGTCAATGGCAATGGCGAGGCCTGA
Gene >OphauB2|6404
ATGTCGGACATGAAGGCGACGGTGGAGGCGACGGAAAAGGGCTTCCAGGTCTGCGGCTATGAAAAGATTGAGTAC
GACTTTGAGTTTCTCGACGGCGTCTTCGAGGTGGCGCACGGGCAGCTGGCGCAGTGCTACAGCAAGTGGAAGCGA
TGCCTGGCCGTCATGGACCTCAACATGTACACGCTGTACGGCGAGCAGATGCAGCGCTACTTTGACCACTACGGC
ATTGAGCTGAGCGTGCACAAGACCATGATTGGGGAAAAGGCCAAGAGCATGGAGACGCTGCTGGGCATTGTCGAC
TCGATGAATGAGTTTGGCGTTTACCGCAAGGAGCCGGTGCTGGTGGTTGGCGGCGGGCTGGTGACTGATGTAGCG
GGGTGAGTTGCGTTCCCCCTTTATTGTAGCAGGCTTCCCCGTCTCCTTGTAGAGGGCCGCTACAGGGGCGCCGCC
GCCACTAACACATGCCCTGGGAGGGCGCCTCAGCTTCGCCTGCGCTGCATACCGCCGCAACACAAACTACATTCG
CATCCCCACCACGGTGATTGGCCTCATTGACGCTTCGGTCTCTATCAAAGTCGCCGTCAACTATGGCCGCTACAA
GAACCGGCTGGGCGCCTACCACGCCCCCATGCACACCTTTCTCGACTTTGGCTTCTTGCGCACGCTGCCCACGGC
GCAGATTCGCAATGGCTTCGCCGAGCTCATCAAGATTTCGTCGTGTGCACACAAGGAGACGCTGGACCTGCTTGA
CGAGCACTGCGAGGCGCTCATTGCCACGGCCTTTGGACGGCTGGACGAGGCAGCGTCGCCTGAGCTGCGGAGCGT
GGCGGATAGGATTTGCCGGGCGGGCATTTACGAGATGCTGAGGCTCGAGACGCCCAATCTGCACGAGATTATGCT
TGACCGCATCATTGCCTATGGACATACGTAAGACTTTTTTTCCCTTGCCCTCCTTTTGTCTTCTTTTTTTTTTTT
GTTACTTTTGCTTCGTCTTGTTATTTCTTTTTGTCATTAAACTTGGTTACAAGATGTTGTACAGAGGCTAACGCG
AGCCTCTAGGTGGTCGCCGCTGCACGAGCTGGTGCCCGATCCTCCACTGCGCCACGGGCACGCCATCTCGATTGA
CATGGCCTACTCGGCCACGCTGGCACACCGCCGCGGCCTGCTCACCGCCAATGACCACGGCCGGCTGCTGCGCCT
CTTTTCACGCGCCGGGCTGGCCATGGACCACGCGCAATTTGACAGCCCGCTGCTGGAGCGCGCCACGGCGGCCAT
TCTCAAGACGCGCGACGGCAAGCTGCGGGCAGCGGTGCCGGTGAGCCCCATGGGCCAGTGTGTCTTTCTCAACGA
CGTGACGCAGGCTGAGATGAGTGCTGCGCTGGATGCGCACAAGGAGCTCATGGCCGAGTATGCGCGTGGTGGTGA
GGGATTGGATGCCTATGTTGATGCGAGCGATACGGGCTATGCGGTGCACGGCGGGCCCGTGGCGGTGGAGGCGCT
GGCGGCTTGCAAGGGACATGTCTCGAGCGGGCTGGATGTGGGTGACAAGTTGCGGCAGAATGGCGCCGTGGCGGT
TAGTGTAGCTGCCCTTGTCAATGGCAATGGCGAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail