Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6392
Gene name
LocationContig_59:28844..29423
Strand-
Gene length (bp)579
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04707 PRELI PRELI-like family 1.8E-40 15 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P35200|UPS2_YEAST Protein UPS2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UPS2 PE=1 SV=1 1 182 6.0E-41
sp|O59707|UPS2_SCHPO UPS-like protein C36.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.10 PE=3 SV=1 1 169 2.0E-31
sp|Q04006|UPS3_YEAST Protein UPS3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UPS3 PE=1 SV=1 1 180 2.0E-29
sp|Q54G07|SLMO_DICDI Protein slowmo homolog OS=Dictyostelium discoideum GN=slmo PE=3 SV=1 9 168 7.0E-25
sp|A5GFX0|PLD3B_PIG PRELI domain containing protein 3B OS=Sus scrofa GN=PRELID3B PE=3 SV=1 1 169 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P35200|UPS2_YEAST Protein UPS2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UPS2 PE=1 SV=1 1 182 6.0E-41
sp|O59707|UPS2_SCHPO UPS-like protein C36.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.10 PE=3 SV=1 1 169 2.0E-31
sp|Q04006|UPS3_YEAST Protein UPS3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UPS3 PE=1 SV=1 1 180 2.0E-29
sp|Q54G07|SLMO_DICDI Protein slowmo homolog OS=Dictyostelium discoideum GN=slmo PE=3 SV=1 9 168 7.0E-25
sp|A5GFX0|PLD3B_PIG PRELI domain containing protein 3B OS=Sus scrofa GN=PRELID3B PE=3 SV=1 1 169 2.0E-21
sp|Q6P9U4|PLD3B_RAT PRELI domain containing protein 3B OS=Rattus norvegicus GN=Prelid3b PE=1 SV=1 1 169 2.0E-21
sp|Q9CYY7|PLD3B_MOUSE PRELI domain containing protein 3B OS=Mus musculus GN=Prelid3b PE=1 SV=2 1 169 5.0E-21
sp|Q9Y3B1|PLD3B_HUMAN PRELI domain containing protein 3B OS=Homo sapiens GN=PRELID3B PE=2 SV=2 1 169 6.0E-21
sp|Q58DB0|PLD3B_BOVIN PRELI domain containing protein 3B OS=Bos taurus GN=PRELID3B PE=2 SV=1 1 169 1.0E-20
sp|Q6TMK8|PLD3B_CRIGR PRELI domain containing protein 3B OS=Cricetulus griseus GN=PRELID3B PE=2 SV=1 1 169 2.0E-20
sp|Q4R5S9|PLD3B_MACFA PRELI domain containing protein 3B OS=Macaca fascicularis GN=PRELID3B PE=2 SV=1 1 169 2.0E-20
sp|Q8VE85|PLD3A_MOUSE PRELI domain containing protein 3A OS=Mus musculus GN=Prelid3a PE=1 SV=1 1 176 5.0E-20
sp|Q96N28|PLD3A_HUMAN PRELI domain containing protein 3A OS=Homo sapiens GN=PRELID3A PE=2 SV=1 1 171 6.0E-19
sp|Q9V3U9|SLMO_DROME Protein slowmo OS=Drosophila melanogaster GN=slmo PE=2 SV=1 1 170 4.0E-18
sp|Q6GM21|PLD3A_XENLA PRELI domain containing protein 3A OS=Xenopus laevis GN=prelid3a PE=2 SV=1 1 176 2.0E-17
sp|Q90673|PRLD1_CHICK PRELI domain-containing protein 1, mitochondrial OS=Gallus gallus GN=PRELID1 PE=2 SV=1 14 168 3.0E-14
sp|Q9V579|PREL_DROME Protein preli-like OS=Drosophila melanogaster GN=prel PE=2 SV=3 10 178 2.0E-13
sp|Q32KN9|PRLD1_BOVIN PRELI domain-containing protein 1, mitochondrial OS=Bos taurus GN=PRELID1 PE=2 SV=1 1 168 1.0E-12
sp|Q05776|UPS1_YEAST Protein UPS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UPS1 PE=1 SV=1 6 169 1.0E-12
sp|Q5BKH5|PRLD2_XENTR PRELI domain-containing protein 2 OS=Xenopus tropicalis GN=prelid2 PE=2 SV=1 10 159 1.0E-11
sp|Q9Y255|PRLD1_HUMAN PRELI domain-containing protein 1, mitochondrial OS=Homo sapiens GN=PRELID1 PE=1 SV=1 1 168 2.0E-11
sp|Q8R107|PRLD1_MOUSE PRELI domain-containing protein 1, mitochondrial OS=Mus musculus GN=Prelid1 PE=1 SV=1 1 168 2.0E-11
sp|Q0VBB0|PRLD2_MOUSE PRELI domain-containing protein 2 OS=Mus musculus GN=Prelid2 PE=2 SV=1 9 173 7.0E-11
sp|Q6NTS7|PRLD2_XENLA PRELI domain-containing protein 2 OS=Xenopus laevis GN=prelid2 PE=2 SV=1 10 152 8.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6392
MKVFSNTVTYDYSWDEVSIANWRKYGPWNNKSEHVIAVDTLSRSVDAATGILRTERLITCRQSAPEWLKTIMGSS
MDVSHVYEASYVDPARRTVTMVSQNLTWSNLVNVQEEVVYRPLGAERTQFEQSARITALCGGWQRIKNSIEDTLV
NRFKENAAKGREGFERVLEMSRKVFAEERERQRLCQPEMQPM*
Coding >OphauB2|6392
ATGAAGGTGTTTTCAAACACTGTGACGTACGACTACTCATGGGACGAGGTGTCCATTGCCAACTGGCGCAAGTAC
GGCCCATGGAACAATAAATCGGAGCACGTCATCGCCGTCGACACGCTGTCGCGCAGCGTCGACGCCGCCACGGGC
ATCCTGCGCACCGAACGTCTCATTACATGCCGCCAGTCGGCGCCCGAGTGGCTCAAGACCATTATGGGCTCGTCC
ATGGACGTGAGCCACGTGTACGAGGCCAGCTATGTGGACCCGGCGCGCCGCACCGTGACAATGGTGAGCCAGAAC
CTGACGTGGAGCAACCTGGTCAATGTCCAGGAGGAAGTCGTCTACCGCCCGCTCGGCGCCGAGCGCACCCAGTTT
GAGCAGAGCGCTCGCATCACGGCCCTGTGCGGCGGCTGGCAGCGCATCAAGAACTCGATTGAGGATACCCTGGTG
AACCGGTTCAAGGAAAACGCCGCAAAGGGCCGCGAGGGCTTTGAGCGCGTCTTGGAAATGAGCCGCAAGGTGTTT
GCAGAGGAACGCGAGCGTCAACGTCTATGCCAGCCCGAGATGCAGCCCATGTAA
Transcript >OphauB2|6392
ATGAAGGTGTTTTCAAACACTGTGACGTACGACTACTCATGGGACGAGGTGTCCATTGCCAACTGGCGCAAGTAC
GGCCCATGGAACAATAAATCGGAGCACGTCATCGCCGTCGACACGCTGTCGCGCAGCGTCGACGCCGCCACGGGC
ATCCTGCGCACCGAACGTCTCATTACATGCCGCCAGTCGGCGCCCGAGTGGCTCAAGACCATTATGGGCTCGTCC
ATGGACGTGAGCCACGTGTACGAGGCCAGCTATGTGGACCCGGCGCGCCGCACCGTGACAATGGTGAGCCAGAAC
CTGACGTGGAGCAACCTGGTCAATGTCCAGGAGGAAGTCGTCTACCGCCCGCTCGGCGCCGAGCGCACCCAGTTT
GAGCAGAGCGCTCGCATCACGGCCCTGTGCGGCGGCTGGCAGCGCATCAAGAACTCGATTGAGGATACCCTGGTG
AACCGGTTCAAGGAAAACGCCGCAAAGGGCCGCGAGGGCTTTGAGCGCGTCTTGGAAATGAGCCGCAAGGTGTTT
GCAGAGGAACGCGAGCGTCAACGTCTATGCCAGCCCGAGATGCAGCCCATGTAA
Gene >OphauB2|6392
ATGAAGGTGTTTTCAAACACTGTGACGTACGACTACTCATGGGACGAGGTGTCCATTGCCAACTGGCGCAAGTAC
GGCCCATGGAACAATAAATCGGAGCACGTCATCGCCGTCGACACGCTGTCGCGCAGCGTCGACGCCGCCACGGGC
ATCCTGCGCACCGAACGTCTCATTACATGCCGCCAGTCGGCGCCCGAGTGGCTCAAGACCATTATGGGCTCGTCC
ATGGACGTGAGCCACGTGTACGAGGCCAGCTATGTGGACCCGGCGCGCCGCACCGTGACAATGGTGAGCCAGAAC
CTGACGTGGAGCAACCTGGTCAATGTCCAGGAGGAAGTCGTCTACCGCCCGCTCGGCGCCGAGCGCACCCAGTTT
GAGCAGAGCGCTCGCATCACGGCCCTGTGCGGCGGCTGGCAGCGCATCAAGAACTCGATTGAGGATACCCTGGTG
AACCGGTTCAAGGAAAACGCCGCAAAGGGCCGCGAGGGCTTTGAGCGCGTCTTGGAAATGAGCCGCAAGGTGTTT
GCAGAGGAACGCGAGCGTCAACGTCTATGCCAGCCCGAGATGCAGCCCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail