Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6381
Gene name
LocationContig_588:34..982
Strand+
Gene length (bp)948
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13821 DUF4187 Domain of unknown function (DUF4187) 1.2E-12 25 70
PF04959 ARS2 Arsenite-resistance protein 2 1.7E-08 135 228

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 38 219 5.0E-15
sp|Q5TUF1|SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae GN=Ars2 PE=3 SV=3 122 227 2.0E-08
sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 122 245 6.0E-07
sp|B4MR46|SRRT_DROWI Serrate RNA effector molecule homolog OS=Drosophila willistoni GN=Ars2 PE=3 SV=1 138 248 8.0E-07
sp|B3MJ69|SRRT_DROAN Serrate RNA effector molecule homolog OS=Drosophila ananassae GN=Ars2 PE=3 SV=1 123 227 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 38 219 5.0E-15
sp|Q5TUF1|SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae GN=Ars2 PE=3 SV=3 122 227 2.0E-08
sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 122 245 6.0E-07
sp|B4MR46|SRRT_DROWI Serrate RNA effector molecule homolog OS=Drosophila willistoni GN=Ars2 PE=3 SV=1 138 248 8.0E-07
sp|B3MJ69|SRRT_DROAN Serrate RNA effector molecule homolog OS=Drosophila ananassae GN=Ars2 PE=3 SV=1 123 227 3.0E-06
sp|B4H732|SRRT_DROPE Serrate RNA effector molecule homolog OS=Drosophila persimilis GN=Ars2 PE=3 SV=1 122 227 4.0E-06
sp|Q28WQ8|SRRT_DROPS Serrate RNA effector molecule homolog OS=Drosophila pseudoobscura pseudoobscura GN=Ars2 PE=3 SV=2 122 227 4.0E-06
sp|Q60436|SRRT_CRIGR Serrate RNA effector molecule homolog (Fragment) OS=Cricetulus griseus GN=SRRT PE=2 SV=3 122 229 5.0E-06
sp|B4NYV0|SRRT_DROYA Serrate RNA effector molecule homolog OS=Drosophila yakuba GN=Ars2 PE=3 SV=1 138 227 5.0E-06
sp|B3N3F7|SRRT_DROER Serrate RNA effector molecule homolog OS=Drosophila erecta GN=Ars2 PE=3 SV=1 138 227 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6381
MDNEEGIVEEEDEEEDGAIDEDDDVDDEDVLIKKKQLDLLIEYLRRVFNFCFFCVFESDSIHELTRKCPGGHLRR
PRSSLSSTARSVARATVNGEPFPDKRRKDSIEEGETEQPETDAKKFRGPSSKTGQQLLRAYNWVKTFEDKLMQIL
DSSSVDLRKLGGRSVEEAVDEELAKHVKQEDEHKWRCKVPECTKLFKEEHFWKKHVEKRHSEWLDSMKQEFELIN
AYWSANLWYASRLQPGATQQHEWHDWNPRLSHSSRRLSHVSQHASS*
Coding >OphauB2|6381
ATGGATAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGATGTG
GATGACGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAACTTC
TGCTTCTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGTAGA
CCTCGGAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGACAAG
AGGCGCAAGGATAGCATTGAAGAGGGTGAGACGGAACAGCCAGAGACAGATGCCAAGAAGTTTCGCGGGCCCTCG
AGCAAGACAGGACAGCAACTTCTGCGAGCGTATAATTGGGTCAAGACGTTTGAAGACAAGCTAATGCAAATTTTG
GACTCCAGTTCTGTTGATCTTCGTAAACTCGGCGGACGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAG
CATGTCAAGCAGGAGGACGAGCATAAGTGGCGATGCAAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACAT
TTTTGGAAGAAGCACGTTGAAAAGAGGCATTCCGAGTGGCTGGACAGTATGAAGCAAGAGTTTGAGCTCATAAAT
GCCTACTGGTCAGCCAATCTCTGGTACGCCTCGCGGCTTCAACCTGGCGCAACTCAACAACATGAATGGCATGAT
TGGAATCCCCGGCTTTCCCATTCCTCCCGGCGGCTTTCCCATGTTTCCCAACATGCAAGCTCCTAA
Transcript >OphauB2|6381
ATGGATAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGATGTG
GATGACGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAACTTC
TGCTTCTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGTAGA
CCTCGGAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGACAAG
AGGCGCAAGGATAGCATTGAAGAGGGTGAGACGGAACAGCCAGAGACAGATGCCAAGAAGTTTCGCGGGCCCTCG
AGCAAGACAGGACAGCAACTTCTGCGAGCGTATAATTGGGTCAAGACGTTTGAAGACAAGCTAATGCAAATTTTG
GACTCCAGTTCTGTTGATCTTCGTAAACTCGGCGGACGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAG
CATGTCAAGCAGGAGGACGAGCATAAGTGGCGATGCAAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACAT
TTTTGGAAGAAGCACGTTGAAAAGAGGCATTCCGAGTGGCTGGACAGTATGAAGCAAGAGTTTGAGCTCATAAAT
GCCTACTGGTCAGCCAATCTCTGGTACGCCTCGCGGCTTCAACCTGGCGCAACTCAACAACATGAATGGCATGAT
TGGAATCCCCGGCTTTCCCATTCCTCCCGGCGGCTTTCCCATGTTTCCCAACATGCAAGCTCCTAA
Gene >OphauB2|6381
ATGGATAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGATGTG
GATGACGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAACTTC
TGCTTCTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGTAGA
CCTCGGAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGACAAG
AGGCGCAAGGATAGCATTGAAGAGGGTGAGACGGAACAGCCAGAGACAGATGCCAAGAAGTTTCGCGGGCCCTCG
AGCAAGACAGGACAGCAACTTCTGCGAGCGTATAATTGGGTCAAGACGTTTGAAGACAAGCTAATGCAAATTTTG
GACTCCAGTTCTGTTGATCTTCGTAAACTCGGCGGACGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAG
CATGTCAAGCAGGAGGACGAGCATAAGTGGCGATGCAAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACAT
TTTTGGAAGAAGCACGTTGAAAAGAGGCATTCCGAGTGGCTGGACAGTATGAAGCAAGAGGTAAGGCTGCCACGC
GGTAAATGCTGTCCACTGGCCTTTTTAACTGACCCCCATGACACAGTTTGAGCTCATAAATGCCTACGTTATGGA
CCCTGCCCATATTGCTCCCTCGCGGACTGATGCAAGCTCCAATGGCCACTTTCCACCAAGCAGTGGTCAGCCAAT
CTCTGGTACGCCTCGCGGCTTCAACCTGGCGCAACTCAACAACATGAATGGCATGATTGGAATCCCCGGCTTTCC
CATTCCTCCCGGCGGCTTTCCCATGTTTCCCAACATGCAAGCTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail