Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6381
Gene name
LocationContig_588:34..982
Strand+
Gene length (bp)948
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13821 DUF4187 Domain of unknown function (DUF4187) 1.2E-12 25 70
PF04959 ARS2 Arsenite-resistance protein 2 1.7E-08 135 228

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 38 219 5.0E-15
sp|Q5TUF1|SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae GN=Ars2 PE=3 SV=3 122 227 2.0E-08
sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 122 245 6.0E-07
sp|B4MR46|SRRT_DROWI Serrate RNA effector molecule homolog OS=Drosophila willistoni GN=Ars2 PE=3 SV=1 138 248 8.0E-07
sp|B3MJ69|SRRT_DROAN Serrate RNA effector molecule homolog OS=Drosophila ananassae GN=Ars2 PE=3 SV=1 123 227 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 38 219 5.0E-15
sp|Q5TUF1|SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae GN=Ars2 PE=3 SV=3 122 227 2.0E-08
sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 122 245 6.0E-07
sp|B4MR46|SRRT_DROWI Serrate RNA effector molecule homolog OS=Drosophila willistoni GN=Ars2 PE=3 SV=1 138 248 8.0E-07
sp|B3MJ69|SRRT_DROAN Serrate RNA effector molecule homolog OS=Drosophila ananassae GN=Ars2 PE=3 SV=1 123 227 3.0E-06
sp|B4H732|SRRT_DROPE Serrate RNA effector molecule homolog OS=Drosophila persimilis GN=Ars2 PE=3 SV=1 122 227 4.0E-06
sp|Q28WQ8|SRRT_DROPS Serrate RNA effector molecule homolog OS=Drosophila pseudoobscura pseudoobscura GN=Ars2 PE=3 SV=2 122 227 4.0E-06
sp|Q60436|SRRT_CRIGR Serrate RNA effector molecule homolog (Fragment) OS=Cricetulus griseus GN=SRRT PE=2 SV=3 122 229 5.0E-06
sp|B4NYV0|SRRT_DROYA Serrate RNA effector molecule homolog OS=Drosophila yakuba GN=Ars2 PE=3 SV=1 138 227 5.0E-06
sp|B3N3F7|SRRT_DROER Serrate RNA effector molecule homolog OS=Drosophila erecta GN=Ars2 PE=3 SV=1 138 227 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup988
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5546
Ophiocordyceps australis map64 (Brazil) OphauB2|4941
Ophiocordyceps australis map64 (Brazil) OphauB2|6381 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07339
Ophiocordyceps camponoti-rufipedis Ophun1|865
Ophiocordyceps kimflemingae Ophio5|1518
Ophiocordyceps subramaniannii Hirsu2|8203

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6381
MDNEEGIVEEEDEEEDGAIDEDDDVDDEDVLIKKKQLDLLIEYLRRVFNFCFFCVFESDSIHELTRKCPGGHLRR
PRSSLSSTARSVARATVNGEPFPDKRRKDSIEEGETEQPETDAKKFRGPSSKTGQQLLRAYNWVKTFEDKLMQIL
DSSSVDLRKLGGRSVEEAVDEELAKHVKQEDEHKWRCKVPECTKLFKEEHFWKKHVEKRHSEWLDSMKQEFELIN
AYWSANLWYASRLQPGATQQHEWHDWNPRLSHSSRRLSHVSQHASS*
Coding >OphauB2|6381
ATGGATAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGATGTG
GATGACGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAACTTC
TGCTTCTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGTAGA
CCTCGGAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGACAAG
AGGCGCAAGGATAGCATTGAAGAGGGTGAGACGGAACAGCCAGAGACAGATGCCAAGAAGTTTCGCGGGCCCTCG
AGCAAGACAGGACAGCAACTTCTGCGAGCGTATAATTGGGTCAAGACGTTTGAAGACAAGCTAATGCAAATTTTG
GACTCCAGTTCTGTTGATCTTCGTAAACTCGGCGGACGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAG
CATGTCAAGCAGGAGGACGAGCATAAGTGGCGATGCAAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACAT
TTTTGGAAGAAGCACGTTGAAAAGAGGCATTCCGAGTGGCTGGACAGTATGAAGCAAGAGTTTGAGCTCATAAAT
GCCTACTGGTCAGCCAATCTCTGGTACGCCTCGCGGCTTCAACCTGGCGCAACTCAACAACATGAATGGCATGAT
TGGAATCCCCGGCTTTCCCATTCCTCCCGGCGGCTTTCCCATGTTTCCCAACATGCAAGCTCCTAA
Transcript >OphauB2|6381
ATGGATAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGATGTG
GATGACGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAACTTC
TGCTTCTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGTAGA
CCTCGGAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGACAAG
AGGCGCAAGGATAGCATTGAAGAGGGTGAGACGGAACAGCCAGAGACAGATGCCAAGAAGTTTCGCGGGCCCTCG
AGCAAGACAGGACAGCAACTTCTGCGAGCGTATAATTGGGTCAAGACGTTTGAAGACAAGCTAATGCAAATTTTG
GACTCCAGTTCTGTTGATCTTCGTAAACTCGGCGGACGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAG
CATGTCAAGCAGGAGGACGAGCATAAGTGGCGATGCAAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACAT
TTTTGGAAGAAGCACGTTGAAAAGAGGCATTCCGAGTGGCTGGACAGTATGAAGCAAGAGTTTGAGCTCATAAAT
GCCTACTGGTCAGCCAATCTCTGGTACGCCTCGCGGCTTCAACCTGGCGCAACTCAACAACATGAATGGCATGAT
TGGAATCCCCGGCTTTCCCATTCCTCCCGGCGGCTTTCCCATGTTTCCCAACATGCAAGCTCCTAA
Gene >OphauB2|6381
ATGGATAACGAGGAAGGCATTGTCGAAGAAGAAGATGAGGAAGAGGATGGAGCCATTGACGAAGACGACGATGTG
GATGACGAAGATGTTCTTATCAAGAAGAAGCAGCTCGACCTCTTGATTGAGTATCTGCGACGAGTCTTCAACTTC
TGCTTCTTTTGCGTCTTTGAGAGCGACTCGATCCACGAGCTCACTCGCAAATGCCCTGGAGGTCATCTTCGTAGA
CCTCGGAGCTCGCTTTCATCCACGGCGCGGTCTGTTGCCCGAGCTACCGTCAATGGCGAACCATTTCCCGACAAG
AGGCGCAAGGATAGCATTGAAGAGGGTGAGACGGAACAGCCAGAGACAGATGCCAAGAAGTTTCGCGGGCCCTCG
AGCAAGACAGGACAGCAACTTCTGCGAGCGTATAATTGGGTCAAGACGTTTGAAGACAAGCTAATGCAAATTTTG
GACTCCAGTTCTGTTGATCTTCGTAAACTCGGCGGACGATCTGTTGAAGAGGCTGTGGACGAGGAGCTGGCAAAG
CATGTCAAGCAGGAGGACGAGCATAAGTGGCGATGCAAAGTTCCAGAATGCACCAAGCTCTTCAAGGAGGAACAT
TTTTGGAAGAAGCACGTTGAAAAGAGGCATTCCGAGTGGCTGGACAGTATGAAGCAAGAGGTAAGGCTGCCACGC
GGTAAATGCTGTCCACTGGCCTTTTTAACTGACCCCCATGACACAGTTTGAGCTCATAAATGCCTACGTTATGGA
CCCTGCCCATATTGCTCCCTCGCGGACTGATGCAAGCTCCAATGGCCACTTTCCACCAAGCAGTGGTCAGCCAAT
CTCTGGTACGCCTCGCGGCTTCAACCTGGCGCAACTCAACAACATGAATGGCATGATTGGAATCCCCGGCTTTCC
CATTCCTCCCGGCGGCTTTCCCATGTTTCCCAACATGCAAGCTCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail