© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauB2|6380 |
| Gene name | |
| Location | Contig_580:333..895 |
| Strand | - |
| Gene length (bp) | 562 |
| Transcript length (bp) | 501 |
| Coding sequence length (bp) | 501 |
| Protein length (aa) | 167 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00501 | AMP-binding | AMP-binding enzyme | 2.4E-16 | 70 | 153 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 37 | 154 | 5.0E-27 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 2 | 150 | 7.0E-24 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 6 | 154 | 9.0E-23 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 2 | 150 | 2.0E-22 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 17 | 154 | 1.0E-21 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 37 | 154 | 5.0E-27 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 2 | 150 | 7.0E-24 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 6 | 154 | 9.0E-23 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 2 | 150 | 2.0E-22 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 17 | 154 | 1.0E-21 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 2 | 150 | 3.0E-21 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 2 | 150 | 6.0E-21 |
| sp|Q4WF53|NRPS4_ASPFU | Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 | 19 | 155 | 1.0E-20 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 10 | 154 | 3.0E-20 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 19 | 150 | 1.0E-19 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 2 | 150 | 1.0E-19 |
| sp|P40806|PKSJ_BACSU | Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 | 2 | 154 | 2.0E-19 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 2 | 150 | 4.0E-19 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 58 | 154 | 5.0E-19 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 1 | 152 | 1.0E-18 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 2 | 150 | 1.0E-18 |
| sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 37 | 154 | 1.0E-18 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 18 | 150 | 2.0E-18 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 2 | 150 | 2.0E-18 |
| sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 62 | 155 | 2.0E-18 |
| sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 62 | 155 | 2.0E-18 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 7 | 147 | 4.0E-18 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 5 | 154 | 4.0E-18 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 2 | 150 | 5.0E-18 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 34 | 150 | 6.0E-18 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 1 | 150 | 9.0E-18 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 18 | 154 | 9.0E-18 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 2 | 150 | 1.0E-17 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 2 | 150 | 4.0E-17 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 33 | 150 | 6.0E-17 |
| sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 2 | 150 | 3.0E-16 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 48 | 150 | 1.0E-15 |
| sp|Q00869|ESYN_FUSEQ | Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 | 2 | 150 | 2.0E-15 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 2 | 150 | 3.0E-15 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 2 | 150 | 3.0E-15 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 24 | 154 | 4.0E-15 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 32 | 154 | 4.0E-15 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 2 | 154 | 5.0E-15 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 23 | 150 | 5.0E-15 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 2 | 150 | 5.0E-15 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 12 | 150 | 6.0E-15 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 34 | 150 | 7.0E-15 |
| sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 18 | 150 | 9.0E-15 |
| sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 2 | 150 | 1.0E-14 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 32 | 150 | 2.0E-14 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 32 | 150 | 2.0E-14 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 18 | 150 | 4.0E-14 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 59 | 150 | 6.0E-14 |
| sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 2 | 150 | 6.0E-14 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 1 | 150 | 8.0E-14 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 62 | 154 | 1.0E-13 |
| sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 1 | 150 | 1.0E-13 |
| sp|O31782|PKSN_BACSU | Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 | 1 | 154 | 2.0E-13 |
| sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 2 | 154 | 3.0E-13 |
| sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 2 | 154 | 4.0E-13 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 2 | 150 | 4.0E-13 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 2 | 150 | 5.0E-13 |
| sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 2 | 154 | 6.0E-13 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 21 | 156 | 6.0E-13 |
| sp|P0C061|GRSA_ANEMI | Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 | 46 | 150 | 7.0E-13 |
| sp|P0C062|GRSA_BREBE | Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 | 46 | 150 | 7.0E-13 |
| sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 2 | 150 | 8.0E-13 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 64 | 150 | 1.0E-12 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 64 | 150 | 1.0E-12 |
| sp|Q4WYP0|NRPS6_ASPFU | Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 | 2 | 149 | 2.0E-12 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 67 | 150 | 2.0E-12 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 2 | 150 | 2.0E-12 |
| sp|Q08787|SRFAC_BACSU | Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 | 2 | 154 | 2.0E-12 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 18 | 155 | 3.0E-12 |
| sp|Q01757|ACVS_STRCL | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 | 21 | 150 | 3.0E-12 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 43 | 150 | 4.0E-12 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 18 | 154 | 5.0E-12 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 2 | 154 | 5.0E-12 |
| sp|Q4WMK2|NRPS9_ASPFU | Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 | 15 | 150 | 5.0E-12 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 48 | 150 | 6.0E-12 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 32 | 150 | 6.0E-12 |
| sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 2 | 150 | 7.0E-12 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 7 | 150 | 8.0E-12 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 45 | 154 | 8.0E-12 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 2 | 152 | 9.0E-12 |
| sp|P09095|TYCA_BREPA | Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 | 63 | 150 | 2.0E-11 |
| sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 59 | 150 | 2.0E-11 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 1 | 150 | 4.0E-11 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 15 | 154 | 5.0E-11 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 15 | 150 | 6.0E-11 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 46 | 150 | 7.0E-11 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 15 | 154 | 8.0E-11 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 15 | 154 | 8.0E-11 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 15 | 151 | 8.0E-11 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 18 | 150 | 9.0E-11 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 64 | 151 | 9.0E-11 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 20 | 150 | 9.0E-11 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 2 | 150 | 1.0E-10 |
| sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 3 | 150 | 1.0E-10 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 46 | 150 | 2.0E-10 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 2 | 150 | 2.0E-10 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 2 | 150 | 2.0E-10 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 63 | 151 | 3.0E-10 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 51 | 154 | 4.0E-10 |
| sp|Q4WLW8|NRP11_ASPFU | Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 | 53 | 150 | 4.0E-10 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 51 | 154 | 5.0E-10 |
| sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 76 | 155 | 1.0E-09 |
| sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 59 | 150 | 5.0E-09 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 2 | 150 | 5.0E-09 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 17 | 152 | 5.0E-09 |
| sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 14 | 151 | 5.0E-09 |
| sp|Q9L9G0|NOVH_STRNV | Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 | 55 | 150 | 6.0E-09 |
| sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 18 | 150 | 8.0E-09 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 18 | 152 | 9.0E-09 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 15 | 150 | 1.0E-08 |
| sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 48 | 154 | 1.0E-08 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 60 | 150 | 2.0E-08 |
| sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 2 | 150 | 2.0E-08 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 20 | 150 | 2.0E-08 |
| sp|P11454|ENTF_ECOLI | Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 | 35 | 154 | 2.0E-08 |
| sp|Q4WMJ7|NRP10_ASPFU | Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 | 66 | 145 | 2.0E-08 |
| sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 67 | 150 | 4.0E-08 |
| sp|P29698|ENTF_SHIFL | Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 | 35 | 154 | 4.0E-08 |
| sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 52 | 150 | 5.0E-08 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 28 | 152 | 6.0E-08 |
| sp|P40976|LYS2_SCHPO | L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 | 1 | 151 | 7.0E-08 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 30 | 150 | 1.0E-07 |
| sp|Q00869|ESYN_FUSEQ | Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 | 59 | 154 | 2.0E-07 |
| sp|Q8XBV9|ENTF_ECO57 | Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 | 35 | 154 | 2.0E-07 |
| sp|Q9R9J1|MYCA_BACIU | Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 | 2 | 154 | 3.0E-07 |
| sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 89 | 150 | 1.0E-06 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 13 | 150 | 3.0E-06 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 13 | 150 | 3.0E-06 |
| sp|O31827|PPSE_BACSU | Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 | 2 | 150 | 4.0E-06 |
| sp|O74298|LYS2_PENCH | L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 | 64 | 151 | 4.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 25 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauB2|6380 MYNPKVLCEAQCLALYHHLQQTVEQLLNQADTPLGQLSIASPWDLEQMTAWNKSAKTTPMHTCVHHLISEQVARA PLKQAIYTTQGILTYHELDTLSTQLAQHLHRLGVGSGSLVPFCMHKSAWAIVAMVAIMKADAAFVPLDPSHPRAR REEMAWFPTWWSYHRL* |
| Coding | >OphauB2|6380 ATGTATAACCCCAAGGTCCTTTGCGAGGCGCAATGTCTTGCTCTTTACCATCACTTGCAGCAAACTGTCGAGCAA CTCTTAAACCAAGCAGATACCCCCCTTGGCCAGCTATCCATTGCCAGTCCCTGGGACCTGGAGCAAATGACTGCG TGGAACAAGTCGGCCAAGACGACTCCCATGCACACCTGCGTCCACCACTTGATTTCGGAACAAGTTGCCCGCGCG CCCCTCAAGCAAGCCATTTACACGACGCAGGGCATCTTGACCTATCACGAGCTCGACACACTGTCTACCCAGCTC GCCCAGCATCTACACAGACTTGGAGTTGGTTCGGGGAGCCTGGTGCCCTTTTGCATGCACAAGTCGGCCTGGGCC ATTGTGGCCATGGTGGCCATTATGAAGGCTGATGCAGCATTTGTGCCTCTTGACCCCTCGCATCCAAGGGCTCGA CGCGAGGAAATGGCATGGTTCCCCACGTGGTGGAGCTATCATCGACTCTAG |
| Transcript | >OphauB2|6380 ATGTATAACCCCAAGGTCCTTTGCGAGGCGCAATGTCTTGCTCTTTACCATCACTTGCAGCAAACTGTCGAGCAA CTCTTAAACCAAGCAGATACCCCCCTTGGCCAGCTATCCATTGCCAGTCCCTGGGACCTGGAGCAAATGACTGCG TGGAACAAGTCGGCCAAGACGACTCCCATGCACACCTGCGTCCACCACTTGATTTCGGAACAAGTTGCCCGCGCG CCCCTCAAGCAAGCCATTTACACGACGCAGGGCATCTTGACCTATCACGAGCTCGACACACTGTCTACCCAGCTC GCCCAGCATCTACACAGACTTGGAGTTGGTTCGGGGAGCCTGGTGCCCTTTTGCATGCACAAGTCGGCCTGGGCC ATTGTGGCCATGGTGGCCATTATGAAGGCTGATGCAGCATTTGTGCCTCTTGACCCCTCGCATCCAAGGGCTCGA CGCGAGGAAATGGCATGGTTCCCCACGTGGTGGAGCTATCATCGACTCTAG |
| Gene | >OphauB2|6380 ATGTATAACCCCAAGGTCCTTTGCGAGGCGCAATGTCTTGCTCTTTACCATCACTTGCAGCAAACTGTCGAGCAA CTCTTAAACCAAGCAGATACCCCCCTTGGCCAGCTATCCATTGCCAGTCCCTGGGACCTGGAGCAAATGACTGCG TGGAACAAGTCGGCCAAGACGACTCCCATGCACACCTGCGTCCACCACTTGATTTCGGAACAAGTTGCCCGCGCG CCCCTCAAGCAAGCCATTTACACGACGCAGGGCATCTTGACCTATCACGAGCTCGACACACTGTCTACCCAGCTC GCCCAGCATCTACACAGACTTGGAGTTGGTTCGGGGAGCCTGGTGCCCTTTTGCATGCACAAGTCGGCCTGGGCC ATTGTGGCCATGGTGGCCATTATGAAGGCTGATGCAGCATTTGTGCCTCTTGACCCCTCGCATCCAAGGGCTCGA CGCGAGGAAATGGTTGGTGAGTTGGGTGCGCGCGCCATGATTGTCACTCCCGAGACTCTTGAGTCTTGCCAAGGC ATGGTTCCCCACGTGGTGGAGCTATCATCGACTCTAG |