Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6377
Gene name
LocationContig_58:105239..106019
Strand+
Gene length (bp)780
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04387 PTPLA Protein tyrosine phosphatase-like protein, PTPLA 1.9E-52 59 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14346|HACD_SCHPO Probable very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C2.15c PE=3 SV=2 12 211 4.0E-42
sp|Q8VZB2|HACD_ARATH Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2 OS=Arabidopsis thaliana GN=PAS2 PE=1 SV=1 12 211 8.0E-30
sp|P40857|HACD_YEAST Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHS1 PE=1 SV=1 14 214 2.0E-29
sp|Q5ZEJ0|HACDB_ORYSJ Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2B OS=Oryza sativa subsp. japonica GN=PAS2B PE=2 SV=1 8 201 8.0E-29
sp|Q7XSZ4|HACDA_ORYSJ Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A OS=Oryza sativa subsp. japonica GN=PAS2A PE=2 SV=2 8 201 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14346|HACD_SCHPO Probable very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C2.15c PE=3 SV=2 12 211 4.0E-42
sp|Q8VZB2|HACD_ARATH Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2 OS=Arabidopsis thaliana GN=PAS2 PE=1 SV=1 12 211 8.0E-30
sp|P40857|HACD_YEAST Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHS1 PE=1 SV=1 14 214 2.0E-29
sp|Q5ZEJ0|HACDB_ORYSJ Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2B OS=Oryza sativa subsp. japonica GN=PAS2B PE=2 SV=1 8 201 8.0E-29
sp|Q7XSZ4|HACDA_ORYSJ Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A OS=Oryza sativa subsp. japonica GN=PAS2A PE=2 SV=2 8 201 2.0E-28
sp|O17040|HACD_CAEEL Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase hpo-8 OS=Caenorhabditis elegans GN=hpo-8 PE=3 SV=2 14 213 6.0E-28
sp|Q9D3B1|HACD2_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Mus musculus GN=Hacd2 PE=1 SV=1 13 213 3.0E-23
sp|Q9QY80|HACD1_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Mus musculus GN=Hacd1 PE=2 SV=1 2 205 4.0E-23
sp|Q2KIP8|HACD2_BOVIN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Bos taurus GN=HACD2 PE=2 SV=2 13 213 4.0E-23
sp|Q6Y1H2|HACD2_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Homo sapiens GN=HACD2 PE=1 SV=1 13 213 7.0E-23
sp|Q5RBK3|HACD2_PONAB Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Pongo abelii GN=HACD2 PE=2 SV=1 13 213 7.0E-23
sp|Q4W1W1|HACD1_CANLF Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Canis lupus familiaris GN=HACD1 PE=2 SV=1 2 205 1.0E-22
sp|B0YJ81|HACD1_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Homo sapiens GN=HACD1 PE=1 SV=1 13 205 2.0E-22
sp|Q9N1R5|HACD1_SHEEP Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Ovis aries GN=HACD1 PE=2 SV=1 13 205 2.0E-21
sp|Q5ZM57|HACD3_CHICK Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Gallus gallus GN=HACD3 PE=2 SV=1 7 211 3.0E-19
sp|Q9P035|HACD3_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens GN=HACD3 PE=1 SV=2 1 211 5.0E-15
sp|Q5NVQ2|HACD3_PONAB Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Pongo abelii GN=HACD3 PE=2 SV=1 1 211 5.0E-15
sp|A7YY55|HACD3_BOVIN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Bos taurus GN=HACD3 PE=2 SV=1 1 211 1.0E-14
sp|Q8K2C9|HACD3_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Mus musculus GN=Hacd3 PE=1 SV=2 9 211 1.0E-13
sp|Q7SY06|HACD3_DANRE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Danio rerio GN=hacd3 PE=2 SV=2 4 200 9.0E-13
sp|A2AKM2|HACD4_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Mus musculus GN=Hacd4 PE=2 SV=2 15 215 5.0E-10
sp|Q5VWC8|HACD4_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Homo sapiens GN=HACD4 PE=1 SV=1 12 214 9.0E-10
sp|Q6GNB5|HACD4_XENLA Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Xenopus laevis GN=hacd4 PE=2 SV=1 15 162 9.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 64 86 22
3 101 123 22
4 143 165 22
5 178 195 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6377
MASKSMPASSPRTAYLIAYNAASALAWAVVLGRTLAVSIGRHSPQLAYAVVGHWTKWTQTMAALEVVHSLLGLVG
APWTTTLMQVASRYLLVWGIVNPFPYLALMPVYASMLTAWSIAEVIRYSYFALSLARCRPAALTWLRYNSFVLLY
PIGILSECCLVYLATEPAGVISPLAKYALYAVLVVYVPGSYVLFSHMVKQRRKVMGSARAKDQKARQ*
Coding >OphauB2|6377
ATGGCGTCCAAGTCAATGCCTGCATCCTCGCCTCGCACCGCCTATCTTATTGCTTATAATGCAGCCTCTGCCCTA
GCCTGGGCTGTGGTGCTGGGCCGCACTCTTGCCGTCAGCATCGGACGCCACAGCCCGCAGCTCGCCTATGCCGTC
GTTGGCCACTGGACAAAGTGGACGCAGACAATGGCCGCTCTCGAGGTGGTCCACTCACTGCTCGGCCTCGTTGGC
GCTCCCTGGACCACGACGCTCATGCAGGTCGCGTCTCGCTACTTGCTCGTCTGGGGCATTGTCAACCCGTTTCCC
TATCTGGCATTGATGCCCGTCTACGCGTCGATGCTTACGGCTTGGTCCATTGCCGAGGTGATTCGCTACTCCTAC
TTTGCCCTTAGCCTGGCGCGTTGCCGTCCCGCCGCCCTGACGTGGCTGCGCTACAACTCGTTTGTCCTACTTTAC
CCAATAGGCATTTTGAGCGAGTGCTGTCTTGTCTACCTGGCCACGGAGCCTGCTGGTGTCATTAGCCCGCTGGCC
AAGTATGCTCTCTACGCCGTGCTTGTGGTGTATGTACCGGGCTCCTACGTCTTGTTCTCGCACATGGTGAAGCAG
AGGCGAAAGGTCATGGGCTCGGCGAGAGCAAAGGACCAAAAGGCAAGGCAATAG
Transcript >OphauB2|6377
ATGGCGTCCAAGTCAATGCCTGCATCCTCGCCTCGCACCGCCTATCTTATTGCTTATAATGCAGCCTCTGCCCTA
GCCTGGGCTGTGGTGCTGGGCCGCACTCTTGCCGTCAGCATCGGACGCCACAGCCCGCAGCTCGCCTATGCCGTC
GTTGGCCACTGGACAAAGTGGACGCAGACAATGGCCGCTCTCGAGGTGGTCCACTCACTGCTCGGCCTCGTTGGC
GCTCCCTGGACCACGACGCTCATGCAGGTCGCGTCTCGCTACTTGCTCGTCTGGGGCATTGTCAACCCGTTTCCC
TATCTGGCATTGATGCCCGTCTACGCGTCGATGCTTACGGCTTGGTCCATTGCCGAGGTGATTCGCTACTCCTAC
TTTGCCCTTAGCCTGGCGCGTTGCCGTCCCGCCGCCCTGACGTGGCTGCGCTACAACTCGTTTGTCCTACTTTAC
CCAATAGGCATTTTGAGCGAGTGCTGTCTTGTCTACCTGGCCACGGAGCCTGCTGGTGTCATTAGCCCGCTGGCC
AAGTATGCTCTCTACGCCGTGCTTGTGGTGTATGTACCGGGCTCCTACGTCTTGTTCTCGCACATGGTGAAGCAG
AGGCGAAAGGTCATGGGCTCGGCGAGAGCAAAGGACCAAAAGGCAAGGCAATAG
Gene >OphauB2|6377
ATGGCGTCCAAGTCAATGCCTGCATCCTCGCCTCGCACCGCCTATCTTATTGCTTATAATGCAGCCTCTGCCCTA
GCCTGGGCTGTGGTGCTGGGCCGCACTCTTGCCGTCAGCATCGGACGCCACAGCCCGCAGCTCGCCTATGCCGTC
GTTGGCCACTGGACAAAGTGGACGCAGACAATGGCCGCTCTCGAGGTGGTCCACTCACTGCTCGGTACGTACAGC
GTGGTTTGCCGCTGAGCTTGGGCAGGATGCTGACGCAGAGAGGCTAGGCCTCGTTGGCGCTCCCTGGACCACGAC
GCTCATGCAGGTCGCGTCTCGCTACTTGCTCGTCTGGGGCATTGTCAACCCGTTTCCCTATCTGGCATTGATGCC
CGTCTACGCGTCGATGCTTACGGCTTGGTCCATTGCCGAGGTGATTCGCTACTCCTACTTTGCCCTTAGCCTGGC
GCGTTGCCGTCCCGCCGCCCTGACGTGGCTGCGCTACAACTCGTTTGTCCTACTTTACCCAATAGGCATTTTGAG
CGAGTGCTGTCTTGTCTACCTGGCCACGGAGCCTGCTGGTGTCATTAGCCCGCTGGCCAAGTATGCTCTCTACGC
CGTGCTTGTGGTGTATGTACCGGGTGAGTCTTGGGACAGGAACAAATCATGGCGCCTTGGCTCGACGACTGGAGC
TGACGCATGCCACTAGGCTCCTACGTCTTGTTCTCGCACATGGTGAAGCAGAGGCGAAAGGTCATGGGCTCGGCG
AGAGCAAAGGACCAAAAGGCAAGGCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail