Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6376
Gene name
LocationContig_58:103526..104728
Strand+
Gene length (bp)1202
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal 5.0E-22 14 139
PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily 6.8E-16 187 296

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q84MB6|DIOX2_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g50210 PE=2 SV=1 14 306 4.0E-25
sp|F4IY03|DIOX1_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g49630 PE=3 SV=1 13 335 1.0E-22
sp|P40902|ISP7_SCHPO Sexual differentiation process protein isp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp7 PE=2 SV=1 6 308 2.0E-21
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 14 274 2.0E-21
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 12 335 4.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q84MB6|DIOX2_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g50210 PE=2 SV=1 14 306 4.0E-25
sp|F4IY03|DIOX1_ARATH Probable 2-oxoglutarate-dependent dioxygenase At3g49630 OS=Arabidopsis thaliana GN=At3g49630 PE=3 SV=1 13 335 1.0E-22
sp|P40902|ISP7_SCHPO Sexual differentiation process protein isp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp7 PE=2 SV=1 6 308 2.0E-21
sp|Q54RA4|Y3291_DICDI Probable iron/ascorbate oxidoreductase DDB_G0283291 OS=Dictyostelium discoideum GN=DDB_G0283291 PE=3 SV=1 14 274 2.0E-21
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 12 335 4.0E-21
sp|A6BM06|ACCO1_DICMU 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium mucoroides GN=aco PE=3 SV=1 14 308 1.0E-20
sp|Q76NT9|ACCO1_DICDI 1-aminocyclopropane-1-carboxylate oxidase OS=Dictyostelium discoideum GN=aco PE=2 SV=1 14 308 1.0E-20
sp|Q8H113|DIN11_ARATH Probable 2-oxoglutarate-dependent dioxygenase DIN11 OS=Arabidopsis thaliana GN=DIN11 PE=2 SV=1 13 335 5.0E-19
sp|Q4PT02|GAOX5_ARATH Gibberellin 20 oxidase 5 OS=Arabidopsis thaliana GN=GA20OX5 PE=2 SV=1 5 318 2.0E-17
sp|O49561|G2OX8_ARATH Gibberellin 2-beta-dioxygenase 8 OS=Arabidopsis thaliana GN=GA2OX8 PE=1 SV=2 10 304 3.0E-16
sp|Q39103|G3OX1_ARATH Gibberellin 3-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA3OX1 PE=1 SV=2 2 335 8.0E-15
sp|Q39112|GAOX3_ARATH Gibberellin 20 oxidase 3 OS=Arabidopsis thaliana GN=GA20OX3 PE=2 SV=1 12 303 2.0E-14
sp|Q39111|GAOX2_ARATH Gibberellin 20 oxidase 2 OS=Arabidopsis thaliana GN=GA20OX2 PE=2 SV=1 12 303 2.0E-13
sp|P93771|GAOX1_ORYSJ Gibberellin 20 oxidase 1 OS=Oryza sativa subsp. japonica GN=20ox1 PE=2 SV=2 6 303 2.0E-13
sp|O04705|GAO1D_WHEAT Gibberellin 20 oxidase 1-D OS=Triticum aestivum GN=GA20ox1D PE=1 SV=1 8 309 2.0E-13
sp|Q9FR99|ACCO_MUSAC 1-aminocyclopropane-1-carboxylate oxidase OS=Musa acuminata GN=MAO1B PE=3 SV=1 12 298 3.0E-13
sp|Q9C971|G3OX4_ARATH Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA3OX4 PE=1 SV=1 1 321 3.0E-13
sp|Q39110|GAOX1_ARATH Gibberellin 20 oxidase 1 OS=Arabidopsis thaliana GN=GA20OX1 PE=2 SV=2 3 303 9.0E-13
sp|Q9XFR9|G2OX2_ARATH Gibberellin 2-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA2OX2 PE=2 SV=1 146 326 1.0E-12
sp|Q08507|ACCO3_PETHY 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Petunia hybrida GN=ACO3 PE=3 SV=1 14 321 1.0E-12
sp|Q9C955|GAOX4_ARATH Gibberellin 20 oxidase 4 OS=Arabidopsis thaliana GN=GA20OX4 PE=2 SV=1 12 303 1.0E-12
sp|Q9LHN8|F6H1_ARATH Feruloyl CoA ortho-hydroxylase 1 OS=Arabidopsis thaliana GN=F6'H1 PE=1 SV=1 210 327 3.0E-12
sp|P41090|FL3H_VITVI Naringenin,2-oxoglutarate 3-dioxygenase OS=Vitis vinifera GN=F3H PE=2 SV=1 3 303 3.0E-12
sp|Q9C6I4|G2OX7_ARATH Gibberellin 2-beta-dioxygenase 7 OS=Arabidopsis thaliana GN=GA2OX7 PE=1 SV=1 6 319 6.0E-12
sp|O65378|ACCO3_ARATH 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Arabidopsis thaliana GN=At1g12010 PE=2 SV=1 146 327 6.0E-12
sp|Q0WPW4|ACCO5_ARATH 1-aminocyclopropane-1-carboxylate oxidase 5 OS=Arabidopsis thaliana GN=At1g77330 PE=2 SV=1 12 322 9.0E-12
sp|Q0JH50|GAOX2_ORYSJ Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. japonica GN=20ox2 PE=1 SV=1 153 311 1.0E-11
sp|P0C5H5|GAOX2_ORYSI Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. indica GN=20ox2 PE=1 SV=1 153 311 1.0E-11
sp|Q9ZT84|G3OX2_ARATH Gibberellin 3-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA3OX2 PE=1 SV=2 189 330 1.0E-11
sp|O04707|GAO1A_WHEAT Gibberellin 20 oxidase 1-A OS=Triticum aestivum GN=GA20ox1A PE=2 SV=1 8 309 1.0E-11
sp|Q04644|ACCO1_CUCME 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Cucumis melo GN=ACO1 PE=2 SV=1 206 321 2.0E-11
sp|Q40062|IDS3_HORVU 2'-deoxymugineic-acid 2'-dioxygenase OS=Hordeum vulgare GN=IDS3 PE=1 SV=3 8 303 2.0E-11
sp|P07920|ACCO2_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Solanum lycopersicum GN=ACO2 PE=2 SV=1 14 321 5.0E-11
sp|Q9C899|F6H2_ARATH Feruloyl CoA ortho-hydroxylase 2 OS=Arabidopsis thaliana GN=F6'H2 PE=1 SV=1 14 327 6.0E-11
sp|P31237|ACCO_ACTDE 1-aminocyclopropane-1-carboxylate oxidase OS=Actinidia deliciosa GN=ACO PE=2 SV=1 14 317 7.0E-11
sp|Q41931|ACCO2_ARATH 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Arabidopsis thaliana GN=ACO2 PE=2 SV=2 9 327 8.0E-11
sp|A2Z1W9|ACCO1_ORYSI 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. indica GN=ACO1 PE=2 SV=1 215 314 9.0E-11
sp|Q7XZQ7|FL3H_PETCR Flavanone 3-dioxygenase OS=Petroselinum crispum GN=FHT PE=1 SV=1 3 303 1.0E-10
sp|P31528|ACCO_DIACA Probable 1-aminocyclopropane-1-carboxylate oxidase OS=Dianthus caryophyllus GN=ACO PE=2 SV=1 146 316 1.0E-10
sp|Q43383|ACCH5_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 5 OS=Arabidopsis thaliana GN=2A6 PE=2 SV=2 150 275 1.0E-10
sp|Q9LTH7|ACH12_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 12 OS=Arabidopsis thaliana GN=At5g59540 PE=2 SV=1 3 327 1.0E-10
sp|Q0J1C1|ACCO1_ORYSJ 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. japonica GN=ACO1 PE=2 SV=1 215 314 2.0E-10
sp|Q09052|ACCO1_BRAJU 1-aminocyclopropane-1-carboxylate oxidase OS=Brassica juncea GN=ACO PE=2 SV=1 146 303 2.0E-10
sp|Q43792|ACCO_TOBAC 1-aminocyclopropane-1-carboxylate oxidase OS=Nicotiana tabacum GN=ACO PE=2 SV=1 14 303 2.0E-10
sp|Q08506|ACCO1_PETHY 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Petunia hybrida GN=ACO1 PE=1 SV=1 146 308 3.0E-10
sp|Q9SVS8|G3OX3_ARATH Gibberellin 3-beta-dioxygenase 3 OS=Arabidopsis thaliana GN=GA3OX3 PE=2 SV=1 213 335 3.0E-10
sp|Q08508|ACCO4_PETHY 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Petunia hybrida GN=ACO4 PE=3 SV=1 28 316 6.0E-10
sp|O64692|G2OX3_ARATH Gibberellin 2-beta-dioxygenase 3 OS=Arabidopsis thaliana GN=GA2OX3 PE=2 SV=1 186 333 8.0E-10
sp|P31238|ACCO1_DORSP 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Doritaenopsis sp. GN=ACO1 PE=2 SV=1 147 308 8.0E-10
sp|P08703|IPNS_PENCH Isopenicillin N synthase OS=Penicillium chrysogenum GN=pcbC PE=3 SV=1 14 274 8.0E-10
sp|Q8S932|ACCO_DIOKA 1-aminocyclopropane-1-carboxylate oxidase OS=Diospyros kaki GN=DK-ACO1 PE=2 SV=1 14 308 9.0E-10
sp|P05116|ACCO1_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Solanum lycopersicum GN=ACO1 PE=2 SV=2 14 303 1.0E-09
sp|Q06588|ACCO4_ARATH 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Arabidopsis thaliana GN=ACO4 PE=1 SV=2 14 303 1.0E-09
sp|Q9XG83|G2OX_PHACN Gibberellin 2-beta-dioxygenase OS=Phaseolus coccineus GN=GA2OX1 PE=2 SV=1 146 326 1.0E-09
sp|P24157|ACCO4_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 4 OS=Solanum lycopersicum GN=ACO4 PE=2 SV=1 29 307 1.0E-09
sp|Q9MB94|ACCO_PRUMU 1-aminocyclopropane-1-carboxylate oxidase OS=Prunus mume GN=ACO1 PE=2 SV=1 14 317 1.0E-09
sp|P54847|ACCO3_CUCME 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Cucumis melo GN=ACO3 PE=2 SV=1 206 316 1.0E-09
sp|Q07353|FL3H_PETHY Naringenin,2-oxoglutarate 3-dioxygenase (Fragment) OS=Petunia hybrida GN=AN3 PE=1 SV=1 131 303 3.0E-09
sp|Q9ZUN4|ACCO1_ARATH 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Arabidopsis thaliana GN=ACO1 PE=2 SV=1 7 307 3.0E-09
sp|Q00985|ACCO1_MALDO 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Malus domestica PE=1 SV=1 146 309 3.0E-09
sp|Q54243|IPNS_STRGR Isopenicillin N synthase OS=Streptomyces griseus GN=pcbC PE=3 SV=1 14 274 4.0E-09
sp|Q8LEA2|G2OX1_ARATH Gibberellin 2-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA2OX1 PE=2 SV=2 1 326 4.0E-09
sp|Q9LTH8|ACH11_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 11 OS=Arabidopsis thaliana GN=At5g59530 PE=2 SV=1 3 275 4.0E-09
sp|P93824|ACCH6_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 6 OS=Arabidopsis thaliana GN=At1g04350 PE=2 SV=1 7 275 4.0E-09
sp|Q06942|FL3H_MALDO Naringenin,2-oxoglutarate 3-dioxygenase OS=Malus domestica PE=2 SV=1 3 303 5.0E-09
sp|P10621|IPNS_STRC2 Isopenicillin N synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=pcbC PE=3 SV=1 14 314 5.0E-09
sp|Q9LSW7|ACCH9_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 9 OS=Arabidopsis thaliana GN=At5g43440 PE=2 SV=1 147 274 5.0E-09
sp|Q84TC2|BX6_MAIZE DIBOA-glucoside dioxygenase BX6 OS=Zea mays GN=BX6 PE=1 SV=1 176 296 6.0E-09
sp|Q05963|FL3H_CALCH Naringenin,2-oxoglutarate 3-dioxygenase OS=Callistephus chinensis GN=FHT PE=2 SV=1 131 303 7.0E-09
sp|Q9LSW6|ACH10_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 10 OS=Arabidopsis thaliana GN=At5g43450 PE=2 SV=1 147 274 8.0E-09
sp|P27744|IPNS_AMYLA Isopenicillin N synthase OS=Amycolatopsis lactamdurans GN=pcbC PE=3 SV=1 14 274 1.0E-08
sp|O48882|ACCO2_MALDO 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Malus domestica GN=ACO2 PE=2 SV=1 146 308 1.0E-08
sp|Q39705|ACCO2_DORSP 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Doritaenopsis sp. GN=ACO2 PE=2 SV=1 147 308 1.0E-08
sp|P93821|ACCH7_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 7 OS=Arabidopsis thaliana GN=At1g04380 PE=1 SV=1 12 275 2.0E-08
sp|Q94A78|ACCH4_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 4 OS=Arabidopsis thaliana GN=At1g03400 PE=2 SV=1 150 275 2.0E-08
sp|Q945B6|AOP1L_ARATH Probable 2-oxoglutarate-dependent dioxygenase AOP1.2 OS=Arabidopsis thaliana GN=AOP1.2 PE=2 SV=1 14 305 2.0E-08
sp|Q9C7Z1|G2OX4_ARATH Gibberellin 2-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA2OX4 PE=2 SV=1 14 297 2.0E-08
sp|Q9ZQZ1|ACCO_DENCR 1-aminocyclopropane-1-carboxylate oxidase OS=Dendrobium crumenatum GN=ACO PE=2 SV=1 206 307 4.0E-08
sp|P10967|ACCH3_SOLLC 1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1 215 295 4.0E-08
sp|Q84MB3|ACCH1_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 1 OS=Arabidopsis thaliana GN=At1g06620 PE=2 SV=1 150 275 4.0E-08
sp|Q9ZTA3|AOP1C_ARATH Probable 2-oxoglutarate-dependent dioxygenase AOP1 OS=Arabidopsis thaliana GN=AOP1 PE=2 SV=1 14 305 5.0E-08
sp|Q944Z5|AOP1V_ARATH Probable 2-oxoglutarate-dependent dioxygenase AOP1 (Fragment) OS=Arabidopsis thaliana GN=AOP1 PE=2 SV=1 14 305 5.0E-08
sp|P51091|LDOX_MALDO Leucoanthocyanidin dioxygenase OS=Malus domestica GN=ANS PE=2 SV=1 8 314 6.0E-08
sp|P31239|ACCO_PEA 1-aminocyclopropane-1-carboxylate oxidase OS=Pisum sativum GN=ACO PE=2 SV=1 206 303 7.0E-08
sp|Q9M2C4|ACCH8_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 8 OS=Arabidopsis thaliana GN=At3g61400 PE=2 SV=1 215 275 9.0E-08
sp|P19464|ACCO_PERAE 1-aminocyclopropane-1-carboxylate oxidase OS=Persea americana GN=ACO PE=2 SV=1 147 308 9.0E-08
sp|O04847|DV4H_CATRO Deacetoxyvindoline 4-hydroxylase OS=Catharanthus roseus GN=D4H PE=1 SV=2 147 275 1.0E-07
sp|A2A1A0|NCS1_COPJA S-norcoclaurine synthase 1 OS=Coptis japonica GN=NCS1 PE=1 SV=1 12 328 3.0E-07
sp|Q9ZTA1|AOP3C_ARATH 2-oxoglutarate-dependent dioxygenase AOP3 OS=Arabidopsis thaliana GN=AOP3 PE=2 SV=1 215 305 4.0E-07
sp|O24648|G3OX_PEA Gibberellin 3-beta-dioxygenase 1 OS=Pisum sativum GN=LE PE=1 SV=1 213 303 7.0E-07
sp|Q7XKU5|DAO_ORYSJ 2-oxoglutarate-dependent dioxygenase DAO OS=Oryza sativa subsp. japonica GN=DAO PE=2 SV=2 215 320 1.0E-06
sp|Q01IX6|DAO_ORYSI 2-oxoglutarate-dependent dioxygenase DAO OS=Oryza sativa subsp. indica GN=DAO PE=3 SV=1 215 320 1.0E-06
sp|Q944X7|AOP3V_ARATH 2-oxoglutarate-dependent dioxygenase AOP3 OS=Arabidopsis thaliana GN=AOP3 PE=2 SV=1 215 305 1.0E-06
sp|Q48739|IPNS_LYSLA Isopenicillin N synthase OS=Lysobacter lactamgenus GN=pcbC PE=3 SV=1 14 304 2.0E-06
sp|Q9SQ80|G2OX1_PEA Gibberellin 2-beta-dioxygenase 1 OS=Pisum sativum GN=GA2OX1 PE=1 SV=1 187 314 2.0E-06
sp|P24397|HY6H_HYONI Hyoscyamine 6-dioxygenase OS=Hyoscyamus niger GN=H6H PE=1 SV=1 14 280 2.0E-06
sp|Q945B4|AOP3L_ARATH 2-oxoglutarate-dependent dioxygenase AOP3 OS=Arabidopsis thaliana GN=AOP3 PE=2 SV=1 215 305 3.0E-06
sp|Q03047|CEFE_AMYLA Deacetoxycephalosporin C synthase OS=Amycolatopsis lactamdurans GN=cefE PE=3 SV=1 14 300 5.0E-06
sp|P16020|IPNS_FLASS Isopenicillin N synthase OS=Flavobacterium sp. (strain SC 12,154) GN=pcbC PE=3 SV=1 14 304 7.0E-06
sp|P51092|LDOX_PETHY Leucoanthocyanidin dioxygenase OS=Petunia hybrida GN=ANT17 PE=2 SV=1 10 318 8.0E-06
sp|Q9FFQ4|FLS5_ARATH Probable flavonol synthase 5 OS=Arabidopsis thaliana GN=FLS5 PE=2 SV=1 186 333 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6376
MAPSMAVSKEGLVIPLIDFSKFLEGAPAEREATARALLHGLQTAGFVYLEKHPIAPSVVRRAFSLTAALFAQPAS
ALQALKWTTPEANRGYSAMGREKVSQLPDNESVQKVRSQMPDLKESLEIGNEDDERFSNKWPDQRGSLVGFRADM
LDFYHQCHELHLCLIKALCMALGSDQTLADSLTNPGDHILRLLHYPAVDATLFDKKPQQIRAGPHTDYGLATLLF
QDSCGGLQVMSPTGSFVDATPIEGTIVVNAGDLLARCSNDLIKSTVHRVVQPPHKTGHQYPARYSIVFFGNPTRD
TVIDTLPGTYTSDEDKKYERVIGTQWLIERLKATY*
Coding >OphauB2|6376
ATGGCGCCTAGCATGGCTGTGAGCAAGGAGGGACTCGTCATTCCTCTCATCGACTTTTCCAAATTCCTCGAGGGA
GCACCTGCTGAGCGCGAGGCGACGGCGCGGGCGCTTCTCCACGGCCTCCAGACCGCCGGCTTCGTCTACCTCGAG
AAGCACCCCATTGCGCCGTCGGTGGTGCGGCGCGCCTTTTCTCTCACAGCCGCCTTGTTTGCACAGCCGGCATCA
GCCTTGCAAGCCCTCAAGTGGACAACGCCCGAGGCTAACCGCGGCTACTCGGCCATGGGCCGTGAAAAGGTGAGC
CAGCTTCCTGACAATGAGTCGGTGCAAAAAGTGCGGAGCCAGATGCCCGACTTGAAGGAGAGCTTGGAGATTGGC
AATGAAGACGATGAGCGCTTCTCCAACAAGTGGCCCGACCAACGCGGCAGCCTCGTGGGTTTCCGAGCCGACATG
CTCGACTTTTACCACCAGTGCCACGAGCTGCACCTTTGCCTCATCAAGGCGCTTTGCATGGCTCTCGGCTCCGAC
CAAACGCTTGCCGACTCGCTGACCAATCCGGGAGATCATATACTTCGATTGCTGCATTATCCTGCTGTCGACGCG
ACTCTTTTTGACAAGAAGCCACAGCAGATTCGTGCCGGGCCACATACGGACTATGGCCTGGCCACTCTGCTCTTC
CAGGACAGCTGCGGGGGGTTGCAGGTCATGAGCCCTACGGGCAGCTTTGTAGATGCCACTCCCATCGAGGGCACC
ATTGTCGTCAATGCGGGCGATTTGCTGGCGCGTTGCAGTAACGACCTCATCAAGAGCACCGTGCACCGCGTGGTG
CAGCCGCCTCACAAGACGGGCCACCAGTATCCCGCCCGGTACAGCATTGTCTTCTTTGGCAATCCAACGCGCGAT
ACCGTCATCGACACGCTGCCGGGCACGTACACGTCTGACGAGGATAAAAAATACGAGAGAGTGATTGGTACCCAG
TGGCTGATTGAAAGGCTCAAGGCGACGTATTAG
Transcript >OphauB2|6376
ATGGCGCCTAGCATGGCTGTGAGCAAGGAGGGACTCGTCATTCCTCTCATCGACTTTTCCAAATTCCTCGAGGGA
GCACCTGCTGAGCGCGAGGCGACGGCGCGGGCGCTTCTCCACGGCCTCCAGACCGCCGGCTTCGTCTACCTCGAG
AAGCACCCCATTGCGCCGTCGGTGGTGCGGCGCGCCTTTTCTCTCACAGCCGCCTTGTTTGCACAGCCGGCATCA
GCCTTGCAAGCCCTCAAGTGGACAACGCCCGAGGCTAACCGCGGCTACTCGGCCATGGGCCGTGAAAAGGTGAGC
CAGCTTCCTGACAATGAGTCGGTGCAAAAAGTGCGGAGCCAGATGCCCGACTTGAAGGAGAGCTTGGAGATTGGC
AATGAAGACGATGAGCGCTTCTCCAACAAGTGGCCCGACCAACGCGGCAGCCTCGTGGGTTTCCGAGCCGACATG
CTCGACTTTTACCACCAGTGCCACGAGCTGCACCTTTGCCTCATCAAGGCGCTTTGCATGGCTCTCGGCTCCGAC
CAAACGCTTGCCGACTCGCTGACCAATCCGGGAGATCATATACTTCGATTGCTGCATTATCCTGCTGTCGACGCG
ACTCTTTTTGACAAGAAGCCACAGCAGATTCGTGCCGGGCCACATACGGACTATGGCCTGGCCACTCTGCTCTTC
CAGGACAGCTGCGGGGGGTTGCAGGTCATGAGCCCTACGGGCAGCTTTGTAGATGCCACTCCCATCGAGGGCACC
ATTGTCGTCAATGCGGGCGATTTGCTGGCGCGTTGCAGTAACGACCTCATCAAGAGCACCGTGCACCGCGTGGTG
CAGCCGCCTCACAAGACGGGCCACCAGTATCCCGCCCGGTACAGCATTGTCTTCTTTGGCAATCCAACGCGCGAT
ACCGTCATCGACACGCTGCCGGGCACGTACACGTCTGACGAGGATAAAAAATACGAGAGAGTGATTGGTACCCAG
TGGCTGATTGAAAGGCTCAAGGCGACGTATTAG
Gene >OphauB2|6376
ATGGCGCCTAGCATGGCTGTGAGCAAGGAGGGACTCGTCATTCCTGTAAGCCAGACTCTCAAGCATAGCAAAAAG
ACAGCACAGCTGGCTCATGGCGCTTCCCACAACTTGTGGGACAAGTGCAAACAGCTCATCGACTTTTCCAAATTC
CTCGAGGGAGCACCTGCTGAGCGCGAGGCGACGGCGCGGGCGCTTCTCCACGGCCTCCAGACCGCCGGCTTCGTC
TACCTCGAGAAGCACCCCATTGCGCCGTCGGTGGTGCGGCGCGCCTTTTCTCTCACAGCCGCCTTGTTTGCACAG
CCGGCATCAGCCTTGCAAGCCCTCAAGTGGACAACGCCCGAGGCTAACCGCGGCTACTCGGCCATGGGCCGTGAA
AAGGTGAGCCAGCTTCCTGACAATGAGTCGGTGCAAAAAGTGCGGAGCCAGATGCCCGACTTGAAGGAGAGCTTG
GAGATTGGCAATGAAGACGATGAGCGCTTCTCCAACAAGTGGCCCGACCAACGCGGCAGCCTCGTGGGTTTCCGA
GCCGACATGCTCGACTTTTACCACCAGTGCCACGAGCTGCACCTTTGCCTCATCAAGGCGCTTTGCATGGCTCTC
GGCTCCGACCAAACGCTTGCCGACTCGCTGACCAATCCGGGAGATCATATACTTCGATTGCTGCATTATCCTGCT
GTCGACGCGACTCTTTTTGACAAGAAGCCACAGCAGATTCGTGCCGGGCCACATACGGTAAGGAAGCCTCGAGAG
ATAAGGACTTGGCTGACGCCATGAATCGCCGCCTAGGACTATGGCCTGGCCACTCTGCTCTTCCAGGACAGCTGC
GGGGGGTTGCAGGTCATGAGCCCTACGGGCAGCTTTGTAGATGCCACTCCCATCGAGGGCACCATTGTCGTCAAT
GCGGGCGATTTGCTGGCGCGTTGCAGTAACGACCTCATCAAGAGCACCGTGCACCGCGTGGTGCAGCCGCCTCAC
AAGACGGGCCACCAGTATCCCGCCCGGTACAGCATTGTGTGAGTGTGCTTCACGAGCCTTGTCGCCTGCCTCGTC
ATTGACCCAGCAAAAACAGCTTCTTTGGCAATCCAACGCGCGATACCGTCATCGACACGCTGCCGGGCACGTACA
CGTCTGACGAGGATAAAAAATACGAGAGAGTGATTGGTACCCAGTGGCTGATTGAAAGGCTCAAGGCGACGTATT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail