Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6375
Gene name
LocationContig_58:101496..102639
Strand-
Gene length (bp)1143
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04909 Amidohydro_2 Amidohydrolase 4.5E-25 9 377

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q54LN9|ACMSD_DICDI 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Dictyostelium discoideum GN=acmsd PE=3 SV=1 82 378 4.0E-24
sp|Q8TDX5|ACMSD_HUMAN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Homo sapiens GN=ACMSD PE=1 SV=1 9 380 3.0E-21
sp|Q8R5M5|ACMSD_RAT 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Rattus norvegicus GN=Acmsd PE=1 SV=1 9 380 4.0E-20
sp|Q8R519|ACMSD_MOUSE 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Mus musculus GN=Acmsd PE=1 SV=2 9 380 5.0E-20
sp|Q0II68|ACMSD_BOVIN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Bos taurus GN=ACMSD PE=2 SV=1 9 380 5.0E-20

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3006
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6862
Ophiocordyceps australis map64 (Brazil) OphauB2|6375 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04979
Ophiocordyceps camponoti-rufipedis Ophun1|5573
Ophiocordyceps kimflemingae Ophio5|580
Ophiocordyceps subramaniannii Hirsu2|5167
Ophiocordyceps subramaniannii Hirsu2|6263

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6375
MALSKPTVVDIHTHMYTPSYIKLLQGRSAIPLVRQFAQAPEPRLVLFESESRALAEALRDPSSAAKTVGRALTPD
YTSLQHKMSFMDAHGIDISVVSPANPWLDFIAADEAGQVAQDVNTEMADMCEQQPGRLYFFGVLPLRATLETVMS
SVQHLQGLQPCRGVIMGTNGMGNGMDDKKLLPVFEALAASQLTLFLHPHQGLPQALGSSSGGADYGHVLPLALGF
PFETTIGVTRMYLSGVFDAVRNLRLILAHSGGTLPFLAGRIESCIQHDAELARAAKGGKERRSVWNVLREQIYLD
ALVYSDVGVAAAIGASGADRLMFGSDHPFFPPLAGMDTDGMWPSVSINATAVTKAVGEGTPEAKAIMGANAIKIL
GLEQK*
Coding >OphauB2|6375
ATGGCTCTCTCCAAGCCCACTGTGGTTGACATCCACACACACATGTACACGCCCTCGTACATCAAGCTTCTCCAA
GGGCGGTCGGCCATTCCACTGGTGCGCCAGTTTGCCCAGGCGCCCGAGCCACGCCTGGTGCTGTTCGAGTCGGAG
TCGCGCGCTCTGGCCGAGGCACTGCGCGACCCTTCGAGCGCGGCAAAGACTGTCGGGCGGGCGCTGACGCCAGAC
TACACGTCGTTGCAGCACAAAATGAGCTTCATGGACGCGCACGGCATCGACATCTCAGTCGTGTCGCCGGCGAAT
CCCTGGCTCGATTTTATTGCTGCCGACGAGGCGGGCCAGGTGGCACAAGACGTCAACACGGAAATGGCCGACATG
TGCGAACAGCAGCCCGGACGCCTCTACTTCTTCGGTGTCTTGCCGCTCAGGGCCACGCTGGAGACGGTCATGAGC
TCTGTGCAGCACTTGCAAGGGCTGCAGCCATGTCGCGGCGTCATCATGGGCACCAACGGCATGGGCAACGGCATG
GATGACAAGAAGCTGCTGCCCGTGTTTGAGGCGCTAGCAGCAAGCCAGCTGACCCTCTTCTTGCATCCGCACCAG
GGACTGCCCCAGGCGCTGGGCAGCAGCAGCGGTGGCGCCGACTACGGACACGTGCTCCCGCTCGCGCTGGGCTTC
CCCTTTGAGACGACGATTGGCGTGACGCGCATGTACCTGTCAGGCGTTTTTGACGCAGTGCGCAATCTGCGCCTC
ATCTTGGCCCATAGTGGGGGAACGCTTCCCTTTCTGGCGGGCCGCATCGAGAGCTGCATCCAGCACGATGCCGAG
CTGGCGAGGGCGGCAAAGGGGGGCAAGGAGAGACGCAGTGTGTGGAATGTGCTGCGCGAGCAAATCTACCTCGAC
GCCCTTGTCTACTCGGACGTGGGCGTGGCGGCTGCCATTGGGGCCAGCGGTGCCGACAGGCTCATGTTTGGCAGC
GACCACCCCTTCTTCCCCCCGCTCGCAGGCATGGACACGGACGGCATGTGGCCCAGTGTGAGCATCAATGCCACT
GCCGTCACCAAGGCGGTGGGTGAGGGGACGCCCGAGGCCAAGGCCATTATGGGGGCCAACGCCATCAAGATTCTC
GGCCTGGAGCAAAAGTAG
Transcript >OphauB2|6375
ATGGCTCTCTCCAAGCCCACTGTGGTTGACATCCACACACACATGTACACGCCCTCGTACATCAAGCTTCTCCAA
GGGCGGTCGGCCATTCCACTGGTGCGCCAGTTTGCCCAGGCGCCCGAGCCACGCCTGGTGCTGTTCGAGTCGGAG
TCGCGCGCTCTGGCCGAGGCACTGCGCGACCCTTCGAGCGCGGCAAAGACTGTCGGGCGGGCGCTGACGCCAGAC
TACACGTCGTTGCAGCACAAAATGAGCTTCATGGACGCGCACGGCATCGACATCTCAGTCGTGTCGCCGGCGAAT
CCCTGGCTCGATTTTATTGCTGCCGACGAGGCGGGCCAGGTGGCACAAGACGTCAACACGGAAATGGCCGACATG
TGCGAACAGCAGCCCGGACGCCTCTACTTCTTCGGTGTCTTGCCGCTCAGGGCCACGCTGGAGACGGTCATGAGC
TCTGTGCAGCACTTGCAAGGGCTGCAGCCATGTCGCGGCGTCATCATGGGCACCAACGGCATGGGCAACGGCATG
GATGACAAGAAGCTGCTGCCCGTGTTTGAGGCGCTAGCAGCAAGCCAGCTGACCCTCTTCTTGCATCCGCACCAG
GGACTGCCCCAGGCGCTGGGCAGCAGCAGCGGTGGCGCCGACTACGGACACGTGCTCCCGCTCGCGCTGGGCTTC
CCCTTTGAGACGACGATTGGCGTGACGCGCATGTACCTGTCAGGCGTTTTTGACGCAGTGCGCAATCTGCGCCTC
ATCTTGGCCCATAGTGGGGGAACGCTTCCCTTTCTGGCGGGCCGCATCGAGAGCTGCATCCAGCACGATGCCGAG
CTGGCGAGGGCGGCAAAGGGGGGCAAGGAGAGACGCAGTGTGTGGAATGTGCTGCGCGAGCAAATCTACCTCGAC
GCCCTTGTCTACTCGGACGTGGGCGTGGCGGCTGCCATTGGGGCCAGCGGTGCCGACAGGCTCATGTTTGGCAGC
GACCACCCCTTCTTCCCCCCGCTCGCAGGCATGGACACGGACGGCATGTGGCCCAGTGTGAGCATCAATGCCACT
GCCGTCACCAAGGCGGTGGGTGAGGGGACGCCCGAGGCCAAGGCCATTATGGGGGCCAACGCCATCAAGATTCTC
GGCCTGGAGCAAAAGTAG
Gene >OphauB2|6375
ATGGCTCTCTCCAAGCCCACTGTGGTTGACATCCACACACACATGTACACGCCCTCGTACATCAAGCTTCTCCAA
GGGCGGTCGGCCATTCCACTGGTGCGCCAGTTTGCCCAGGCGCCCGAGCCACGCCTGGTGCTGTTCGAGTCGGAG
TCGCGCGCTCTGGCCGAGGCACTGCGCGACCCTTCGAGCGCGGCAAAGACTGTCGGGCGGGCGCTGACGCCAGAC
TACACGTCGTTGCAGCACAAAATGAGCTTCATGGACGCGCACGGCATCGACATCTCAGTCGTGTCGCCGGCGAAT
CCCTGGCTCGATTTTATTGCTGCCGACGAGGCGGGCCAGGTGGCACAAGACGTCAACACGGAAATGGCCGACATG
TGCGAACAGCAGCCCGGACGCCTCTACTTCTTCGGTGTCTTGCCGCTCAGGGCCACGCTGGAGACGGTCATGAGC
TCTGTGCAGCACTTGCAAGGGCTGCAGCCATGTCGCGGCGTCATCATGGGCACCAACGGCATGGGCAACGGCATG
GATGACAAGAAGCTGCTGCCCGTGTTTGAGGCGCTAGCAGCAAGCCAGCTGACCCTCTTCTTGCATCCGCACCAG
GGACTGCCCCAGGCGCTGGGCAGCAGCAGCGGTGGCGCCGACTACGGACACGTGCTCCCGCTCGCGCTGGGCTTC
CCCTTTGAGACGACGATTGGCGTGACGCGCATGTACCTGTCAGGCGTTTTTGACGCAGTGCGCAATCTGCGCCTC
ATCTTGGCCCATAGTGGGGGAACGCTTCCCTTTCTGGCGGGCCGCATCGAGAGCTGCATCCAGCACGATGCCGAG
CTGGCGAGGGCGGCAAAGGGGGGCAAGGAGAGACGCAGTGTGTGGAATGTGCTGCGCGAGCAAATCTACCTCGAC
GCCCTTGTCTACTCGGACGTGGGCGTGGCGGCTGCCATTGGGGCCAGCGGTGCCGACAGGCTCATGTTTGGCAGC
GACCACCCCTTCTTCCCCCCGCTCGCAGGCATGGACACGGACGGCATGTGGCCCAGTGTGAGCATCAATGCCACT
GCCGTCACCAAGGCGGTGGGTGAGGGGACGCCCGAGGCCAAGGCCATTATGGGGGCCAACGCCATCAAGATTCTC
GGCCTGGAGCAAAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail