Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6361
Gene name
LocationContig_58:71740..72336
Strand+
Gene length (bp)596
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01124 MAPEG MAPEG family 1.0E-14 17 150

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 104 122 18
3 129 151 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6361
MCSIMRLDMAKDFSLFTVPAVLIATCMGPHMYAVLKAGKLYDNANPRGFKEAVDKSEGLDKATKRRIMRAQAASD
NGFETLGLYAAGVVAARVAGVNPCQVNRLAAGYLAARLAYVAVYVHLQEDRRMASLRSLVWLTSIGLAVSLWVRA
GLEALRR*
Coding >OphauB2|6361
ATGTGCTCCATCATGAGACTCGACATGGCCAAGGACTTTTCCCTCTTCACGGTGCCGGCAGTGCTGATAGCGACG
TGCATGGGGCCGCACATGTACGCCGTGCTCAAGGCAGGCAAGTTGTACGACAATGCGAACCCGCGCGGCTTCAAG
GAAGCCGTGGACAAGAGCGAGGGGCTGGACAAGGCGACCAAGCGGCGCATCATGCGAGCGCAGGCAGCCTCGGAC
AATGGGTTTGAGACGCTGGGCCTGTATGCGGCGGGAGTGGTTGCGGCTCGCGTGGCGGGCGTGAATCCGTGCCAG
GTCAACCGACTGGCAGCCGGCTACCTGGCGGCGCGCCTGGCATACGTGGCTGTCTATGTGCACCTGCAAGAGGAT
CGGCGCATGGCGTCGCTGCGGTCGCTTGTGTGGCTGACGAGCATTGGGCTGGCCGTTTCGCTGTGGGTGCGCGCC
GGGCTCGAGGCGCTGCGGCGCTGA
Transcript >OphauB2|6361
ATGTGCTCCATCATGAGACTCGACATGGCCAAGGACTTTTCCCTCTTCACGGTGCCGGCAGTGCTGATAGCGACG
TGCATGGGGCCGCACATGTACGCCGTGCTCAAGGCAGGCAAGTTGTACGACAATGCGAACCCGCGCGGCTTCAAG
GAAGCCGTGGACAAGAGCGAGGGGCTGGACAAGGCGACCAAGCGGCGCATCATGCGAGCGCAGGCAGCCTCGGAC
AATGGGTTTGAGACGCTGGGCCTGTATGCGGCGGGAGTGGTTGCGGCTCGCGTGGCGGGCGTGAATCCGTGCCAG
GTCAACCGACTGGCAGCCGGCTACCTGGCGGCGCGCCTGGCATACGTGGCTGTCTATGTGCACCTGCAAGAGGAT
CGGCGCATGGCGTCGCTGCGGTCGCTTGTGTGGCTGACGAGCATTGGGCTGGCCGTTTCGCTGTGGGTGCGCGCC
GGGCTCGAGGCGCTGCGGCGCTGA
Gene >OphauB2|6361
ATGTGCTCCATCATGAGACTCGACATGGCCAAGGACTTTTCCCTCTTCACGGTAAGCATGCGGCGTGGCGATTCG
AGGCGGTGCAGGAGCCATTGACCAGTCTTGCATCAGGTGCCGGCAGTGCTGATAGCGACGTGCATGGGGCCGCAC
ATGTACGCCGTGCTCAAGGCAGGCAAGTTGTACGACAATGCGAACCCGCGCGGCTTCAAGGAAGCCGTGGACAAG
AGCGAGGGGCTGGACAAGGCGGTAGGAAGACGTCATGGGACTCGCTTGGGGAACAAGAAGACGGCTGACGGAGCG
AGGAGCAGACCAAGCGGCGCATCATGCGAGCGCAGGCAGCCTCGGACAATGGGTTTGAGACGCTGGGCCTGTATG
CGGCGGGAGTGGTTGCGGCTCGCGTGGCGGGCGTGAATCCGTGCCAGGTCAACCGACTGGCAGCCGGCTACCTGG
CGGCGCGCCTGGCATACGTGGCTGTCTATGTGCACCTGCAAGAGGATCGGCGCATGGCGTCGCTGCGGTCGCTTG
TGTGGCTGACGAGCATTGGGCTGGCCGTTTCGCTGTGGGTGCGCGCCGGGCTCGAGGCGCTGCGGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail