Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6353
Gene name
LocationContig_58:43418..46606
Strand-
Gene length (bp)3188
Transcript length (bp)2877
Coding sequence length (bp)2877
Protein length (aa) 959

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 1.1E-13 530 664
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.3E-05 85 107
PF00096 zf-C2H2 Zinc finger, C2H2 type 6.7E-05 113 135
PF13894 zf-C2H2_4 C2H2-type zinc finger 6.0E-04 113 135
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.3E-05 157 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 77 143 7.0E-11
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 77 135 1.0E-10
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 77 135 1.0E-10
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 77 135 1.0E-10
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 77 135 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 77 143 7.0E-11
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 77 135 1.0E-10
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 77 135 1.0E-10
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 77 135 1.0E-10
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 77 135 2.0E-10
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 77 176 2.0E-10
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 77 135 2.0E-10
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 77 135 2.0E-10
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 77 143 3.0E-10
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 77 135 3.0E-10
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 77 135 4.0E-10
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 77 135 4.0E-10
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 77 135 7.0E-10
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 77 135 9.0E-10
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 77 135 9.0E-10
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 77 135 1.0E-09
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 77 135 2.0E-09
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 77 135 2.0E-09
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 77 135 2.0E-09
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 77 135 2.0E-09
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 77 135 2.0E-09
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 77 135 3.0E-09
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 77 135 3.0E-09
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 77 135 3.0E-09
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 77 135 3.0E-09
sp|Q3B7M4|ZN746_BOVIN Zinc finger protein 746 OS=Bos taurus GN=ZNF746 PE=2 SV=1 79 145 4.0E-09
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 77 140 8.0E-09
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 77 137 8.0E-09
sp|Q6NUN9|ZN746_HUMAN Zinc finger protein 746 OS=Homo sapiens GN=ZNF746 PE=1 SV=1 79 135 9.0E-09
sp|Q3U133|ZN746_MOUSE Zinc finger protein 746 OS=Mus musculus GN=Znf746 PE=1 SV=3 79 135 9.0E-09
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 10 131 1.0E-08
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 77 148 1.0E-08
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 78 142 1.0E-08
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 77 148 1.0E-08
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 77 135 1.0E-08
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 77 144 1.0E-08
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 77 144 1.0E-08
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 79 154 2.0E-08
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 2.0E-08
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 32 135 2.0E-08
sp|P53243|YG2A_YEAST Zinc finger protein YGR067C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR067C PE=3 SV=2 80 206 2.0E-08
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 77 144 2.0E-08
sp|Q9ULD5|ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens GN=ZNF777 PE=1 SV=2 77 135 3.0E-08
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 77 137 3.0E-08
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 77 142 4.0E-08
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 76 135 5.0E-08
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 77 154 5.0E-08
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 77 137 5.0E-08
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 77 137 5.0E-08
sp|Q14119|VEZF1_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens GN=VEZF1 PE=1 SV=2 77 135 5.0E-08
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 5.0E-08
sp|P18726|ZG5A_XENLA Gastrula zinc finger protein XlCGF51.1A (Fragment) OS=Xenopus laevis PE=3 SV=1 65 135 6.0E-08
sp|P56270|MAZ_HUMAN Myc-associated zinc finger protein OS=Homo sapiens GN=MAZ PE=1 SV=1 77 135 7.0E-08
sp|P56671|MAZ_MOUSE Myc-associated zinc finger protein OS=Mus musculus GN=Maz PE=1 SV=1 77 135 7.0E-08
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 79 136 7.0E-08
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 85 135 7.0E-08
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 77 135 8.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 77 135 8.0E-08
sp|Q9HBE1|PATZ1_HUMAN POZ-, AT hook-, and zinc finger-containing protein 1 OS=Homo sapiens GN=PATZ1 PE=1 SV=1 77 135 8.0E-08
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 77 131 9.0E-08
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 77 135 9.0E-08
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 78 135 9.0E-08
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 77 143 9.0E-08
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 77 135 1.0E-07
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 77 135 1.0E-07
sp|Q8N0Y2|ZN444_HUMAN Zinc finger protein 444 OS=Homo sapiens GN=ZNF444 PE=1 SV=1 4 138 1.0E-07
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 77 135 1.0E-07
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 77 135 1.0E-07
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 77 135 1.0E-07
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 66 131 1.0E-07
sp|Q9HAH1|ZN556_HUMAN Zinc finger protein 556 OS=Homo sapiens GN=ZNF556 PE=2 SV=1 77 135 1.0E-07
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 73 168 1.0E-07
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 77 143 1.0E-07
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 77 154 1.0E-07
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 77 135 1.0E-07
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 77 142 1.0E-07
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 78 135 2.0E-07
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 2.0E-07
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 79 137 2.0E-07
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 79 137 2.0E-07
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 77 135 2.0E-07
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 77 135 2.0E-07
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 77 138 2.0E-07
sp|Q5ANC8|TRY4_CANAL Transcriptional regulator of yeast form adherence 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY4 PE=2 SV=1 82 134 2.0E-07
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 78 135 2.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 78 135 2.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 78 135 2.0E-07
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 77 135 2.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 77 135 2.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 77 142 2.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 56 165 2.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 77 142 2.0E-07
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 78 135 2.0E-07
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 83 139 2.0E-07
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 78 135 2.0E-07
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 77 135 3.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 77 135 3.0E-07
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 77 135 3.0E-07
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 77 139 3.0E-07
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 78 135 3.0E-07
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 78 135 3.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 77 142 3.0E-07
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 83 139 3.0E-07
sp|P39959|YEW0_YEAST Zinc finger protein YER130C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER130C PE=3 SV=2 81 136 3.0E-07
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 77 135 3.0E-07
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 77 135 3.0E-07
sp|Q9UL58|ZN215_HUMAN Zinc finger protein 215 OS=Homo sapiens GN=ZNF215 PE=2 SV=2 79 140 3.0E-07
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 76 136 3.0E-07
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 77 142 3.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 77 140 3.0E-07
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 77 135 4.0E-07
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 71 149 4.0E-07
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 79 135 4.0E-07
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 77 137 4.0E-07
sp|P18719|ZG32_XENLA Gastrula zinc finger protein XlCGF32.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 4.0E-07
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 77 135 4.0E-07
sp|P18739|ZO10_XENLA Oocyte zinc finger protein XlCOF10 (Fragment) OS=Xenopus laevis PE=3 SV=1 73 157 4.0E-07
sp|Q6AY34|OSR2_RAT Protein odd-skipped-related 2 OS=Rattus norvegicus GN=Osr2 PE=2 SV=1 26 142 4.0E-07
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 55 135 4.0E-07
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 77 138 4.0E-07
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 77 135 4.0E-07
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 4.0E-07
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 77 135 4.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 77 138 4.0E-07
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 77 135 4.0E-07
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 77 135 4.0E-07
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 79 135 4.0E-07
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 5.0E-07
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 77 135 5.0E-07
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 77 135 5.0E-07
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 77 135 5.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 77 135 5.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 77 135 5.0E-07
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 77 159 5.0E-07
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 77 135 5.0E-07
sp|P18716|ZG28_XENLA Gastrula zinc finger protein XlCGF28.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 79 135 5.0E-07
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 77 173 6.0E-07
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 77 135 6.0E-07
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 77 144 6.0E-07
sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=1 SV=2 26 142 6.0E-07
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 77 135 6.0E-07
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 131 6.0E-07
sp|Q9ESX2|SP6_MOUSE Transcription factor Sp6 OS=Mus musculus GN=Sp6 PE=2 SV=2 77 135 6.0E-07
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 77 186 6.0E-07
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 77 144 6.0E-07
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 78 135 7.0E-07
sp|Q59RR3|MNL1_CANAL Transcriptional regulator MNL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNL1 PE=3 SV=1 82 135 7.0E-07
sp|P86413|OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis GN=osr1 PE=2 SV=1 47 142 7.0E-07
sp|Q5RE50|ZN215_PONAB Zinc finger protein 215 OS=Pongo abelii GN=ZNF215 PE=2 SV=1 79 140 7.0E-07
sp|Q3T135|OSR2_BOVIN Protein odd-skipped-related 2 OS=Bos taurus GN=OSR2 PE=2 SV=1 30 142 7.0E-07
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 77 144 7.0E-07
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 62 142 8.0E-07
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 79 135 8.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 77 131 8.0E-07
sp|Q567J8|OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio GN=osr2 PE=2 SV=1 58 142 8.0E-07
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 79 135 8.0E-07
sp|Q00453|RGM1_YEAST Probable transcription repressor protein RGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGM1 PE=1 SV=2 89 131 8.0E-07
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 77 182 8.0E-07
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 79 151 9.0E-07
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 77 135 9.0E-07
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 154 9.0E-07
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 78 135 9.0E-07
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 56 135 1.0E-06
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 1.0E-06
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 154 1.0E-06
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 79 137 1.0E-06
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 1.0E-06
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 79 151 1.0E-06
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 77 142 1.0E-06
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 56 138 1.0E-06
sp|O73694|EGR1_SERCA Early growth response protein 1 (Fragment) OS=Serinus canaria GN=EGR1 PE=3 SV=1 77 120 1.0E-06
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 26 142 1.0E-06
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 26 142 1.0E-06
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 85 131 1.0E-06
sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens GN=KLF16 PE=1 SV=1 77 135 1.0E-06
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 85 179 1.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 77 135 1.0E-06
sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 30 142 1.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 55 142 1.0E-06
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 85 142 1.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 77 142 1.0E-06
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 77 142 1.0E-06
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 85 142 1.0E-06
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 77 135 1.0E-06
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 77 142 1.0E-06
sp|Q9Y7G2|MIG1_CANAX Regulatory protein MIG1 OS=Candida albicans GN=MIG1 PE=3 SV=1 85 145 1.0E-06
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 79 142 1.0E-06
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 73 131 1.0E-06
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 77 135 1.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 77 142 1.0E-06
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 77 135 1.0E-06
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 77 135 1.0E-06
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 85 283 2.0E-06
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 2.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 79 135 2.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 79 135 2.0E-06
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 77 135 2.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 79 135 2.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 79 135 2.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 79 135 2.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 79 135 2.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 77 135 2.0E-06
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 77 165 2.0E-06
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 81 135 2.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 79 135 2.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 79 135 2.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 77 135 2.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 77 135 2.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 77 135 2.0E-06
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 77 142 2.0E-06
sp|B0K011|OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus GN=Osr1 PE=2 SV=1 85 142 2.0E-06
sp|Q9WVG7|OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus GN=Osr1 PE=2 SV=1 85 142 2.0E-06
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 77 135 2.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 77 135 2.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 77 135 2.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 78 163 2.0E-06
sp|Q03081|MET31_YEAST Transcriptional regulator MET31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET31 PE=1 SV=1 78 131 2.0E-06
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 77 142 2.0E-06
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 77 141 2.0E-06
sp|Q10076|HSR1_SCHPO Hydrogen peroxide stress regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsr1 PE=2 SV=1 71 139 2.0E-06
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 77 135 2.0E-06
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 77 135 2.0E-06
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 79 142 2.0E-06
sp|Q5XJQ7|OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio GN=osr1 PE=2 SV=1 85 142 2.0E-06
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 77 135 2.0E-06
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 77 136 2.0E-06
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 32 131 2.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 77 142 2.0E-06
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 77 147 2.0E-06
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 69 137 2.0E-06
sp|Q96K62|ZBT45_HUMAN Zinc finger and BTB domain-containing protein 45 OS=Homo sapiens GN=ZBTB45 PE=2 SV=1 50 156 2.0E-06
sp|P41995|ODD1_CAEEL Zinc finger protein odd-1 OS=Caenorhabditis elegans GN=odd-1 PE=2 SV=2 85 142 2.0E-06
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 90 131 2.0E-06
sp|P08044|SNAI_DROME Protein snail OS=Drosophila melanogaster GN=sna PE=1 SV=2 77 135 2.0E-06
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 77 135 2.0E-06
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 53 135 2.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 77 135 2.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 77 167 2.0E-06
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 77 135 2.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 73 135 2.0E-06
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 77 135 2.0E-06
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 77 142 2.0E-06
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 79 135 2.0E-06
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 2.0E-06
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 77 135 2.0E-06
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 77 135 2.0E-06
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 55 145 2.0E-06
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 79 135 2.0E-06
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 61 135 2.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 77 135 2.0E-06
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 79 135 2.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 79 135 2.0E-06
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 56 135 2.0E-06
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 39 135 2.0E-06
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 77 135 2.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 77 135 2.0E-06
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 72 144 2.0E-06
sp|Q86UQ0|ZN589_HUMAN Zinc finger protein 589 OS=Homo sapiens GN=ZNF589 PE=1 SV=1 78 135 2.0E-06
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 85 131 2.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 39 136 2.0E-06
sp|Q8N0Y2|ZN444_HUMAN Zinc finger protein 444 OS=Homo sapiens GN=ZNF444 PE=1 SV=1 85 137 3.0E-06
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 77 135 3.0E-06
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 142 3.0E-06
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 56 137 3.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 73 135 3.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 78 144 3.0E-06
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 79 135 3.0E-06
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 77 135 3.0E-06
sp|Q6DCW1|GFI1B_XENLA Zinc finger protein Gfi-1b OS=Xenopus laevis GN=gfi1b PE=2 SV=1 79 136 3.0E-06
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 77 153 3.0E-06
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 3.0E-06
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 77 135 3.0E-06
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 56 135 3.0E-06
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 77 135 3.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 73 135 3.0E-06
sp|Q66JF8|OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis GN=osr1 PE=2 SV=1 85 142 3.0E-06
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 73 149 3.0E-06
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 77 135 3.0E-06
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 3.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 77 135 3.0E-06
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 79 145 3.0E-06
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 77 163 3.0E-06
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 77 135 3.0E-06
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 77 135 3.0E-06
sp|P18743|ZO2_XENLA Oocyte zinc finger protein XlCOF2 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 3.0E-06
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 77 136 3.0E-06
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 77 137 3.0E-06
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 77 137 3.0E-06
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 77 137 3.0E-06
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 77 141 3.0E-06
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 77 131 3.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 78 135 3.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 78 144 3.0E-06
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 81 142 3.0E-06
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 77 135 3.0E-06
sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster GN=ham PE=2 SV=1 77 154 3.0E-06
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 79 178 4.0E-06
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 77 135 4.0E-06
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 77 135 4.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 77 135 4.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 77 135 4.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 77 135 4.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 77 135 4.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 79 135 4.0E-06
sp|Q5TC79|ZBT37_HUMAN Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens GN=ZBTB37 PE=2 SV=1 77 135 4.0E-06
sp|P26635|EGR2_POERE Early growth response protein 2 (Fragment) OS=Poecilia reticulata GN=egr2 PE=3 SV=1 77 120 4.0E-06
sp|Q86UZ6|ZBT46_HUMAN Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens GN=ZBTB46 PE=1 SV=2 77 156 4.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 78 135 4.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 78 144 4.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 77 142 4.0E-06
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 79 137 4.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 77 171 4.0E-06
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 77 135 4.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 77 135 4.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 77 171 4.0E-06
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 77 147 4.0E-06
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 77 137 4.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 85 141 4.0E-06
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 56 135 4.0E-06
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 56 135 4.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 77 137 4.0E-06
sp|Q9Z1D8|ZKSC5_MOUSE Zinc finger protein with KRAB and SCAN domains 5 OS=Mus musculus GN=Zkscan5 PE=2 SV=2 73 142 4.0E-06
sp|P26633|EGR2_CRIGR E3 SUMO-protein ligase EGR2 (Fragment) OS=Cricetulus griseus GN=EGR2 PE=2 SV=1 77 120 4.0E-06
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 77 135 4.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 77 135 4.0E-06
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 77 135 4.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 77 135 5.0E-06
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 73 135 5.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 77 135 5.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 56 135 5.0E-06
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 77 135 5.0E-06
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 77 137 5.0E-06
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 79 137 5.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 77 141 5.0E-06
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 77 135 5.0E-06
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 55 135 5.0E-06
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 69 137 5.0E-06
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 55 153 5.0E-06
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 77 135 5.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 77 135 6.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 77 135 6.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 77 135 6.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 77 141 6.0E-06
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 77 135 6.0E-06
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 77 135 6.0E-06
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 77 135 6.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 77 135 6.0E-06
sp|Q9ERR8|ZN319_MOUSE Zinc finger protein 319 OS=Mus musculus GN=Znf319 PE=2 SV=1 56 135 6.0E-06
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 27 142 6.0E-06
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 77 135 6.0E-06
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 77 135 6.0E-06
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 77 140 6.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 77 135 7.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 55 122 7.0E-06
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 77 135 7.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 77 135 7.0E-06
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 77 135 7.0E-06
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 77 135 7.0E-06
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 11 142 7.0E-06
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 77 153 7.0E-06
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 27 142 7.0E-06
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 77 135 7.0E-06
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 27 142 7.0E-06
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 79 142 7.0E-06
sp|Q99M85|SCRT1_MOUSE Transcriptional repressor scratch 1 OS=Mus musculus GN=Scrt1 PE=1 SV=1 77 131 7.0E-06
sp|Q6XDT6|IKZF_MYXGL Ikaros family zinc finger protein OS=Myxine glutinosa PE=1 SV=2 77 135 7.0E-06
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 27 142 7.0E-06
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 77 135 7.0E-06
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 77 142 7.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 56 135 7.0E-06
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 56 135 7.0E-06
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 77 135 7.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 77 135 7.0E-06
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 77 135 7.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 77 135 7.0E-06
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 55 135 7.0E-06
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 77 135 7.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 77 135 8.0E-06
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 77 135 8.0E-06
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 55 153 8.0E-06
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 77 135 8.0E-06
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 72 138 8.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 77 142 8.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 77 135 8.0E-06
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 77 137 8.0E-06
sp|O43623|SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens GN=SNAI2 PE=1 SV=1 77 131 8.0E-06
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 56 135 8.0E-06
sp|P10074|ZBT48_HUMAN Zinc finger and BTB domain-containing protein 48 OS=Homo sapiens GN=ZBTB48 PE=1 SV=2 32 142 8.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 77 135 8.0E-06
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 77 135 8.0E-06
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 33 135 8.0E-06
sp|P81183|IKZF2_MOUSE Zinc finger protein Helios OS=Mus musculus GN=Ikzf2 PE=1 SV=2 77 188 8.0E-06
sp|Q3KNW1|SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens GN=SNAI3 PE=2 SV=1 77 131 8.0E-06
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 90 131 8.0E-06
sp|Q9UKS7|IKZF2_HUMAN Zinc finger protein Helios OS=Homo sapiens GN=IKZF2 PE=1 SV=2 77 188 8.0E-06
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 77 135 8.0E-06
sp|Q9P2F9|ZN319_HUMAN Zinc finger protein 319 OS=Homo sapiens GN=ZNF319 PE=1 SV=2 56 135 8.0E-06
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 77 135 8.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 77 135 9.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 77 135 9.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 77 135 9.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 56 135 9.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 77 135 9.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 77 135 9.0E-06
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 77 135 9.0E-06
sp|Q02526|ZFP41_MOUSE Zinc finger protein 41 OS=Mus musculus GN=Zfp41 PE=2 SV=2 73 135 9.0E-06
sp|Q9ULM2|ZN490_HUMAN Zinc finger protein 490 OS=Homo sapiens GN=ZNF490 PE=1 SV=2 77 135 9.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 77 142 9.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 55 135 9.0E-06
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 77 135 9.0E-06
sp|Q02085|SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus GN=Snai1 PE=1 SV=1 77 131 9.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 77 135 9.0E-06
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 77 135 9.0E-06
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 56 135 9.0E-06
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 76 136 9.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 77 135 1.0E-05
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 77 135 1.0E-05
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 79 135 1.0E-05
sp|P97469|SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus GN=Snai2 PE=1 SV=1 77 131 1.0E-05
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 79 135 1.0E-05
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 53 135 1.0E-05
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 77 135 1.0E-05
sp|Q9QY31|SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus GN=Snai3 PE=2 SV=1 77 131 1.0E-05
sp|Q9H9D4|ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens GN=ZNF408 PE=1 SV=1 37 135 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008270 zinc ion binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0140110 transcription regulator activity No
GO:0010468 regulation of gene expression No
GO:0043170 macromolecule metabolic process No
GO:0046914 transition metal ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0016070 RNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009987 cellular process No
GO:0019222 regulation of metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0050794 regulation of cellular process No
GO:1901363 heterocyclic compound binding No
GO:0044249 cellular biosynthetic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0065007 biological regulation No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6353
MTGPSLSHILDSPRPVSQPRDAQGSLEYANFASPVAAASSRAPSPYPPALGHVAPPAAAPASAPPLSSAPPSTPA
GRSHAGSNLYACRDCGRSYSRPEHLVRHVQTHTLGRRFTCDVCSKSFARKDLLRRHVANHGNSSSHKRRQMISSP
AAGRVMQACRPCAVARVKCDETKPCRRCLDRNIACLVPDSSAATATHLAHPPPVAKASPNPVSEDYSTPTAHGPT
SAASIPAPDALSSPSNTPISQQTPYRPDDGQLPTPDAATDNAFSQPLSRPSALSNVVMGINLNSPFSDFLRDILY
QQPFDPARCSETQSLAPLDFCDNSNLELTDVDFGLLDYWNLDGMTQGTLPMSEAGHISEGAAGISQMRPSLVQAW
AVSPWRWDPKSNDTGYKEQGFLPLSAKDTSSAQFLESRNRLQRVVSEKLEQPSRDRVLAIVLSTCGKNLTANRVA
SSFPTVEVLDVLVHIFLAAQACQVDEWIHFPTLKLNEQWPEWIAMAAAMGGALTPMPTLRKFGFAVQEAVRVTIP
SRFEENNTAIQRLGLVQSLILVQDLGLWSGNRRKMEIAECHLVIPVTMMRYRGQFQRCRYPTLTVEATDQGDVLE
KKWRYWIEREQWKRLVFHCYIREAQTSMTTLTNPCISYSELTLPLPEARELWLAKDAGEWKGHYLERNRGQVKRP
PSVGDILRDVHILGNNYMRLDVQYSMSIFLHGFWTLILEYRQLSSVQHTRSYVDSAGNSHAYLLKTRHDELVRDL
DTFELAVARWQDMSAREHLVLNLLMLNLHVSLDDLQLFSGKEGEDQARRIYPVLQRWAATSESRAAVWRGAQVLR
YAKLFPTDHLSGFWAVAVHHAALALWTYGVVLRAHGRQAGPGAGQFVASDAVYLDQGDSAAIQAFREADQGRPMI
KGPATGQASLYDPRACMSIAQEILRSNFGRGQELPPLVENVCQIVQQLGDAAWAVGLG*
Coding >OphauB2|6353
ATGACTGGTCCATCGCTCTCTCATATTCTCGATTCTCCGCGCCCCGTCTCGCAGCCTCGTGATGCGCAAGGCTCA
CTTGAGTATGCCAATTTCGCCTCACCTGTCGCAGCCGCCTCGAGCCGTGCGCCCTCTCCGTATCCTCCAGCCCTT
GGGCATGTGGCTCCGCCTGCTGCTGCTCCAGCGTCGGCGCCGCCTCTTTCGTCCGCTCCGCCCTCGACACCGGCA
GGAAGAAGCCATGCAGGAAGCAATCTCTATGCCTGCCGCGACTGTGGACGCTCCTATTCACGGCCCGAACACCTC
GTTCGCCATGTGCAGACTCATACCCTCGGCCGCCGCTTCACATGCGATGTATGCTCCAAGTCGTTTGCTCGCAAG
GACTTGTTGCGGCGACACGTTGCCAATCATGGCAACAGCTCGTCACACAAGCGTCGCCAAATGATATCGTCGCCA
GCTGCCGGCCGTGTCATGCAGGCCTGTCGTCCCTGTGCCGTGGCCAGGGTCAAGTGCGACGAGACCAAGCCGTGT
CGGCGCTGCCTTGACCGCAACATTGCTTGCCTTGTTCCCGACTCGAGCGCTGCTACCGCCACGCACCTGGCCCAT
CCACCGCCCGTGGCCAAGGCGAGTCCGAATCCCGTCTCTGAAGACTACTCAACTCCGACTGCTCATGGCCCAACT
TCTGCTGCCTCGATACCCGCACCGGACGCTCTGTCAAGCCCATCAAACACCCCCATTTCGCAGCAGACACCCTAC
AGGCCAGACGATGGCCAATTGCCCACGCCAGATGCAGCTACAGACAATGCCTTTTCTCAGCCCCTTAGTCGTCCT
AGCGCCCTGTCCAACGTTGTCATGGGCATCAACTTGAACTCGCCATTCTCTGATTTTTTACGCGACATACTCTAC
CAACAGCCGTTTGATCCTGCCAGATGCTCCGAGACCCAAAGTCTCGCGCCTCTTGACTTTTGTGACAATTCGAAT
CTGGAGCTCACCGATGTCGACTTTGGTCTTTTGGACTACTGGAACCTCGACGGCATGACCCAAGGCACGCTGCCA
ATGTCAGAGGCAGGCCACATCTCTGAAGGCGCAGCCGGAATATCTCAGATGCGACCAAGTCTTGTTCAGGCATGG
GCTGTGTCTCCCTGGCGCTGGGACCCCAAGAGCAATGATACTGGCTACAAAGAACAGGGCTTCCTTCCCCTCTCG
GCCAAGGACACATCGAGCGCCCAGTTTCTCGAGAGTCGCAACCGGCTGCAGAGAGTGGTATCAGAAAAGCTTGAA
CAGCCAAGCCGGGACCGTGTCTTGGCAATTGTCCTCTCAACCTGTGGCAAGAACCTGACAGCCAACCGAGTGGCT
TCGTCCTTTCCAACCGTTGAAGTGCTTGATGTGCTGGTTCACATCTTTCTTGCGGCTCAGGCCTGCCAGGTAGAC
GAATGGATACACTTTCCGACTTTGAAGCTCAACGAGCAGTGGCCGGAGTGGATAGCCATGGCGGCTGCCATGGGC
GGTGCACTGACGCCCATGCCTACGCTTCGCAAATTTGGGTTTGCCGTGCAGGAGGCGGTCCGCGTTACTATACCC
TCCCGATTTGAAGAGAACAACACGGCAATTCAAAGGCTTGGGCTGGTCCAGTCCCTGATTCTCGTGCAGGATTTG
GGCTTATGGAGTGGCAACAGACGCAAGATGGAGATTGCAGAGTGCCATCTCGTGATACCAGTGACTATGATGCGC
TATCGCGGGCAGTTTCAGCGGTGCAGGTACCCGACCTTGACAGTTGAAGCCACTGATCAAGGCGATGTGTTGGAG
AAGAAGTGGAGGTATTGGATCGAAAGGGAGCAGTGGAAGCGGCTGGTGTTTCATTGCTACATTCGAGAAGCGCAG
ACGTCCATGACGACTCTGACGAATCCATGCATTTCGTATTCGGAATTGACGCTGCCTTTGCCAGAGGCCAGAGAG
CTGTGGCTGGCCAAGGACGCTGGCGAGTGGAAAGGGCACTACTTGGAGAGGAACCGGGGACAGGTGAAGAGGCCG
CCTTCGGTGGGGGATATTTTGCGGGATGTGCACATCTTGGGCAACAATTACATGCGTCTTGACGTACAGTACTCC
ATGTCGATTTTTCTTCACGGCTTCTGGACCCTGATTCTGGAGTATCGGCAGCTAAGCTCTGTGCAACACACGCGA
AGCTACGTGGACAGCGCAGGCAACAGCCACGCATACTTGCTCAAGACAAGACACGACGAGCTGGTGAGGGACCTG
GATACGTTTGAGCTGGCTGTCGCCAGATGGCAGGACATGTCGGCGCGAGAGCACCTCGTCCTGAACCTGCTCATG
CTCAACCTGCATGTCTCGCTCGACGACTTGCAGCTCTTCTCGGGAAAGGAAGGTGAAGACCAAGCGCGACGCATC
TACCCGGTGCTGCAGCGATGGGCGGCGACTTCAGAGTCGCGAGCGGCTGTGTGGCGCGGCGCACAGGTGCTGCGA
TATGCCAAGCTCTTCCCGACGGACCACCTCAGCGGCTTTTGGGCAGTGGCGGTGCACCACGCGGCCCTGGCGCTG
TGGACGTACGGGGTGGTCTTGAGGGCTCACGGGCGGCAGGCAGGGCCAGGGGCAGGGCAGTTTGTGGCGTCGGAC
GCCGTCTATCTGGACCAAGGCGACTCGGCAGCGATACAGGCCTTCCGCGAAGCCGACCAAGGGCGGCCCATGATC
AAGGGGCCGGCGACGGGCCAGGCCTCGCTGTACGACCCGCGCGCGTGCATGAGCATTGCTCAGGAGATTCTGCGC
TCCAACTTTGGGCGCGGACAGGAGCTGCCGCCTCTGGTGGAAAATGTGTGCCAGATTGTGCAGCAGCTGGGCGAT
GCGGCCTGGGCTGTTGGCCTGGGCTAG
Transcript >OphauB2|6353
ATGACTGGTCCATCGCTCTCTCATATTCTCGATTCTCCGCGCCCCGTCTCGCAGCCTCGTGATGCGCAAGGCTCA
CTTGAGTATGCCAATTTCGCCTCACCTGTCGCAGCCGCCTCGAGCCGTGCGCCCTCTCCGTATCCTCCAGCCCTT
GGGCATGTGGCTCCGCCTGCTGCTGCTCCAGCGTCGGCGCCGCCTCTTTCGTCCGCTCCGCCCTCGACACCGGCA
GGAAGAAGCCATGCAGGAAGCAATCTCTATGCCTGCCGCGACTGTGGACGCTCCTATTCACGGCCCGAACACCTC
GTTCGCCATGTGCAGACTCATACCCTCGGCCGCCGCTTCACATGCGATGTATGCTCCAAGTCGTTTGCTCGCAAG
GACTTGTTGCGGCGACACGTTGCCAATCATGGCAACAGCTCGTCACACAAGCGTCGCCAAATGATATCGTCGCCA
GCTGCCGGCCGTGTCATGCAGGCCTGTCGTCCCTGTGCCGTGGCCAGGGTCAAGTGCGACGAGACCAAGCCGTGT
CGGCGCTGCCTTGACCGCAACATTGCTTGCCTTGTTCCCGACTCGAGCGCTGCTACCGCCACGCACCTGGCCCAT
CCACCGCCCGTGGCCAAGGCGAGTCCGAATCCCGTCTCTGAAGACTACTCAACTCCGACTGCTCATGGCCCAACT
TCTGCTGCCTCGATACCCGCACCGGACGCTCTGTCAAGCCCATCAAACACCCCCATTTCGCAGCAGACACCCTAC
AGGCCAGACGATGGCCAATTGCCCACGCCAGATGCAGCTACAGACAATGCCTTTTCTCAGCCCCTTAGTCGTCCT
AGCGCCCTGTCCAACGTTGTCATGGGCATCAACTTGAACTCGCCATTCTCTGATTTTTTACGCGACATACTCTAC
CAACAGCCGTTTGATCCTGCCAGATGCTCCGAGACCCAAAGTCTCGCGCCTCTTGACTTTTGTGACAATTCGAAT
CTGGAGCTCACCGATGTCGACTTTGGTCTTTTGGACTACTGGAACCTCGACGGCATGACCCAAGGCACGCTGCCA
ATGTCAGAGGCAGGCCACATCTCTGAAGGCGCAGCCGGAATATCTCAGATGCGACCAAGTCTTGTTCAGGCATGG
GCTGTGTCTCCCTGGCGCTGGGACCCCAAGAGCAATGATACTGGCTACAAAGAACAGGGCTTCCTTCCCCTCTCG
GCCAAGGACACATCGAGCGCCCAGTTTCTCGAGAGTCGCAACCGGCTGCAGAGAGTGGTATCAGAAAAGCTTGAA
CAGCCAAGCCGGGACCGTGTCTTGGCAATTGTCCTCTCAACCTGTGGCAAGAACCTGACAGCCAACCGAGTGGCT
TCGTCCTTTCCAACCGTTGAAGTGCTTGATGTGCTGGTTCACATCTTTCTTGCGGCTCAGGCCTGCCAGGTAGAC
GAATGGATACACTTTCCGACTTTGAAGCTCAACGAGCAGTGGCCGGAGTGGATAGCCATGGCGGCTGCCATGGGC
GGTGCACTGACGCCCATGCCTACGCTTCGCAAATTTGGGTTTGCCGTGCAGGAGGCGGTCCGCGTTACTATACCC
TCCCGATTTGAAGAGAACAACACGGCAATTCAAAGGCTTGGGCTGGTCCAGTCCCTGATTCTCGTGCAGGATTTG
GGCTTATGGAGTGGCAACAGACGCAAGATGGAGATTGCAGAGTGCCATCTCGTGATACCAGTGACTATGATGCGC
TATCGCGGGCAGTTTCAGCGGTGCAGGTACCCGACCTTGACAGTTGAAGCCACTGATCAAGGCGATGTGTTGGAG
AAGAAGTGGAGGTATTGGATCGAAAGGGAGCAGTGGAAGCGGCTGGTGTTTCATTGCTACATTCGAGAAGCGCAG
ACGTCCATGACGACTCTGACGAATCCATGCATTTCGTATTCGGAATTGACGCTGCCTTTGCCAGAGGCCAGAGAG
CTGTGGCTGGCCAAGGACGCTGGCGAGTGGAAAGGGCACTACTTGGAGAGGAACCGGGGACAGGTGAAGAGGCCG
CCTTCGGTGGGGGATATTTTGCGGGATGTGCACATCTTGGGCAACAATTACATGCGTCTTGACGTACAGTACTCC
ATGTCGATTTTTCTTCACGGCTTCTGGACCCTGATTCTGGAGTATCGGCAGCTAAGCTCTGTGCAACACACGCGA
AGCTACGTGGACAGCGCAGGCAACAGCCACGCATACTTGCTCAAGACAAGACACGACGAGCTGGTGAGGGACCTG
GATACGTTTGAGCTGGCTGTCGCCAGATGGCAGGACATGTCGGCGCGAGAGCACCTCGTCCTGAACCTGCTCATG
CTCAACCTGCATGTCTCGCTCGACGACTTGCAGCTCTTCTCGGGAAAGGAAGGTGAAGACCAAGCGCGACGCATC
TACCCGGTGCTGCAGCGATGGGCGGCGACTTCAGAGTCGCGAGCGGCTGTGTGGCGCGGCGCACAGGTGCTGCGA
TATGCCAAGCTCTTCCCGACGGACCACCTCAGCGGCTTTTGGGCAGTGGCGGTGCACCACGCGGCCCTGGCGCTG
TGGACGTACGGGGTGGTCTTGAGGGCTCACGGGCGGCAGGCAGGGCCAGGGGCAGGGCAGTTTGTGGCGTCGGAC
GCCGTCTATCTGGACCAAGGCGACTCGGCAGCGATACAGGCCTTCCGCGAAGCCGACCAAGGGCGGCCCATGATC
AAGGGGCCGGCGACGGGCCAGGCCTCGCTGTACGACCCGCGCGCGTGCATGAGCATTGCTCAGGAGATTCTGCGC
TCCAACTTTGGGCGCGGACAGGAGCTGCCGCCTCTGGTGGAAAATGTGTGCCAGATTGTGCAGCAGCTGGGCGAT
GCGGCCTGGGCTGTTGGCCTGGGCTAG
Gene >OphauB2|6353
ATGACTGGTCCATCGCTCTCTCATATTCTCGATTCTCCGCGCCCCGTCTCGCAGCCTCGTGATGCGCAAGGCTCA
CTTGAGTATGCCAATTTCGCCTCACCTGTCGCAGCCGCCTCGAGCCGTGCGCCCTCTCCGTATCCTCCAGCCCTT
GGGCATGTGGCTCCGCCTGCTGCTGCTCCAGCGTCGGCGCCGCCTCTTTCGTCCGCTCCGCCCTCGACACCGGCA
GGAAGAAGCCATGCAGGAAGCAATCTCTATGCCTGCCGCGACTGTGGACGCTCCTATTCACGGCCCGAACACCTC
GTTCGCCATGTGCAGACTCATACCCTCGGCCGCCGCTTCACATGCGATGTATGCTCCAAGTCGTTTGCTCGCAAG
GACTTGTTGCGGCGACACGTTGCCAATCATGGCAACAGCTCGTCACACAAGCGTCGCCAAATGATATCGTCGCCA
GCTGCCGGCCGTGTCATGCAGGCCTGTCGTCCCTGTGCCGTGGCCAGGGTCAAGTGCGACGAGACCAAGCCGTGT
CGGCGCTGCCTTGACCGCAACATTGCTTGCCTTGTTCCCGACTCGAGCGCTGCTACCGCCACGCACCTGGCCCAT
CCACCGCCCGTGGCCAAGGCGAGTCCGAATCCCGTCTCTGAAGACTACTCAACTCCGACTGCTCATGGCCCAACT
TCTGCTGCCTCGATACCCGCACCGGACGCTCTGTCAAGCCCATCAAACACCCCCATTTCGCAGCAGACACCCTAC
AGGCCAGACGATGGCCAATTGCCCACGCCAGATGCAGCTACAGACAATGGTAAAGCTCGTTGGTCTTGACCGCTA
TCCCGACGTGTTTGCCGCTGACTTGTACAAGCCTTTTCTCAGCCCCTTAGTCGTCCTAGCGCCCTGTCCAACGTT
GTCATGGGCATCAACTTGAACTCGCCATTCTCTGATTTTTTACGCGACATACTCTACCAACAGCCGTTTGATCCT
GCCAGATGCTCCGAGACCCAAAGTCTCGCGCCTCTTGACTTTTGTGACAATTCGAATCTGGAGCTCACCGATGTC
GACTTTGGTCTTTTGGACTACTGGAACCTCGACGGCATGACCCAAGGCACGCTGCCAATGTCAGAGGCAGGCCAC
ATCTCTGAAGGCGCAGCCGGAATATCTCAGATGCGACCAAGTCTTGTTCAGGCATGGGCTGTGTCTCCCTGGCGC
TGGGACCCCAAGAGCAATGATACTGGCTACAAAGAACAGGGCTTCCTTCCCCTCTCGGCCAAGGACACATCGAGC
GCCCAGTTTCTCGAGAGTCGCAACCGGCTGCAGAGAGTGGTATCAGAAAAGCTTGAACAGCCAAGCCGGGACCGT
GTCTTGGCAATTGTCCTCTCAACCTGTGGCAAGAACCTGACAGCCAACCGAGTGGCTTCGTCCTTTCCAACCGTT
GAAGTGCTTGATGTGCTGGTTCACATCTTTCTTGCGGCTCAGGCCTGCCAGGTAGACGAATGGATACACTTTCCG
ACTTTGAAGCTCAACGAGCAGTGGCCGGAGTGGATAGCCATGGCGGCTGCCATGGGCGGTGCACTGACGCCCATG
CCTACGCTTCGCAAATTTGGGTTTGCCGTGCAGGAGGCGGTCCGTAAGTTGGGAAGCCCCGTCGTACAGTTGATG
AATGCATGCTTACCTGGACCGTTCGAAAAGGCGTTACTATACCCTCCCGAGTGCGTACAGACCTGTGCCATTTTA
CTGACCTCTTGCTATGCATTGTCGACTAAAGCAGTGTCTTTACAGTTTGAAGAGAACAACACGGCAATTCAAAGG
CTTGGGCTGGTCCAGTCCCTGATTCTCGTGCAGGATTTGGGCTTATGGAGTGGCAACAGACGCAAGATGGAGATT
GCAGAGTGCCATCTCGTGATACCAGTGACTGTGAGCGATGTTGTATGCTTTTGGATATCTGGCCCGCATAGGACT
GACTTGTGACTATCACCAGATGATGCGCTATCGCGGGCAGTTTCAGCGGTGCAGGTACCCGACCTTGACAGTTGA
AGCCACTGATCAAGGCGATGTGTTGGAGAAGAAGTGGAGGTATTGGATCGAAAGGGAGCAGTGGAAGCGGTACGT
TGACGAGAGCGCCATGGCAGAGAGAAGTGGTGCTAACTTGGGCGGGGCAAAGGCTGGTGTTTCATTGCTACATTC
GAGAAGCGCAGACGTCCATGACGACTCTGACGAATCCATGCATTTCGTATTCGGAATTGACGCTGCCTTTGCCAG
AGGCCAGAGAGCTGTGGCTGGCCAAGGACGCTGGCGAGTGGAAAGGGCACTACTTGGAGAGGAACCGGGGACAGG
TGAAGAGGCCGCCTTCGGTGGGGGATATTTTGCGGGATGTGCACATCTTGGGCAACAATTACATGCGTCTTGACG
TACAGTACTCCATGTCGATTTTTCTTCACGGCTTCTGGACCCTGATTCTGGAGTATCGGCAGCTAAGCTCTGTGC
AACACACGCGAAGCTACGTGGACAGCGCAGGCAACAGCCACGCATACTTGCTCAAGACAAGACACGACGAGCTGG
TGAGGGACCTGGATACGTTTGAGCTGGCTGTCGCCAGATGGCAGGACATGTCGGCGCGAGAGCACCTCGTCCTGA
ACCTGCTCATGCTCAACCTGCATGTCTCGCTCGACGACTTGCAGCTCTTCTCGGGAAAGGAAGGTGAAGACCAAG
CGCGACGCATCTACCCGGTGCTGCAGCGATGGGCGGCGACTTCAGAGTCGCGAGCGGCTGTGTGGCGCGGCGCAC
AGGTGCTGCGATATGCCAAGCTCTTCCCGACGGACCACCTCAGCGGCTTTTGGGCAGTGGCGGTGCACCACGCGG
CCCTGGCGCTGTGGACGTACGGGGTGGTCTTGAGGGCTCACGGGCGGCAGGCAGGGCCAGGGGCAGGGCAGTTTG
TGGCGTCGGACGCCGTCTATCTGGACCAAGGCGACTCGGCAGCGATACAGGCCTTCCGCGAAGCCGACCAAGGGC
GGCCCATGATCAAGGGGCCGGCGACGGGCCAGGCCTCGCTGTACGACCCGCGCGCGTGCATGAGCATTGCTCAGG
AGATTCTGCGCTCCAACTTTGGGCGCGGACAGGAGCTGCCGCCTCTGGTGGAAAATGTGTGCCAGATTGTGCAGC
AGCTGGGCGATGCGGCCTGGGCTGTTGGCCTGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail