Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6352
Gene name
LocationContig_58:41584..42891
Strand-
Gene length (bp)1307
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 5.2E-10 93 205
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.7E-09 94 373
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.1E-06 94 202

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0A573|Y2734_MYCBO Uncharacterized protein Mb2734 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2734 PE=3 SV=1 66 221 7.0E-06
sp|P9WNH3|Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2715 PE=1 SV=1 66 221 7.0E-06
sp|P9WNH2|Y2715_MYCTO Uncharacterized protein MT2788 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2788 PE=3 SV=1 66 221 7.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6352
MALAIPWPLSTAALVAATALATTALLVLARTALWPRRRRVLPSPLHTLAETKEPRMRLGSWLYPTDAFPGGRDVE
TPYGSMRVYEFGPQDGPKVLFVHGISTPCMTLSLLAQACVARGCRVMLFDLFGRGYSDGVGDLPHDARLYSSQIL
CALASSPLPWTGSQARLRLVGYSMGGSLAVCFANAFPDLVASLVLMAPAGLIRPTDFGTLSRILFRSGLLPDRIV
TVLARRRLQAPIVASRLSPKAMAAATLAAAEATNLNRATATNKETRSRDKQQEPPLQERMLEYVRWMVLHHHGFV
AAFMSCIRHAPLLDESESWRLLARRPPGSTAVLLADADEIINADHYTSHGLALVGGPDRVVWRVLPGSHDFVMTH
VESVMGVLDDFWDMKKLG*
Coding >OphauB2|6352
ATGGCCTTGGCGATACCATGGCCCTTGTCAACAGCAGCGCTCGTGGCGGCAACAGCCCTGGCGACAACGGCTTTG
CTGGTGCTGGCGCGCACAGCTCTCTGGCCAAGACGCAGGCGCGTGCTGCCAAGTCCGCTGCACACATTGGCCGAG
ACCAAGGAGCCGAGAATGCGCCTGGGCAGCTGGTTATACCCGACGGATGCCTTTCCTGGAGGCCGTGACGTCGAG
ACACCATACGGCTCGATGCGCGTCTACGAATTCGGCCCTCAAGACGGACCAAAGGTGCTTTTTGTGCATGGCATC
AGTACACCTTGTATGACACTATCCCTGCTTGCTCAGGCCTGTGTTGCCCGTGGCTGCCGCGTCATGCTATTTGAT
CTCTTTGGCCGTGGCTATTCCGATGGTGTTGGCGATCTTCCCCACGATGCCCGTCTTTACTCGTCGCAGATACTG
TGCGCCCTTGCCTCGAGCCCGCTGCCCTGGACGGGATCTCAGGCACGACTGCGCCTGGTTGGTTATTCCATGGGC
GGCTCTCTGGCAGTCTGCTTCGCCAATGCCTTCCCCGACCTTGTCGCCTCGCTCGTCCTCATGGCCCCGGCAGGA
TTGATTCGGCCCACCGACTTTGGCACCCTGTCTCGTATCCTCTTCCGTTCTGGCCTGCTGCCCGATCGCATTGTT
ACTGTCCTTGCCCGACGGCGCTTGCAGGCTCCCATTGTTGCCTCTCGCCTCTCGCCCAAGGCCATGGCGGCAGCC
ACCCTGGCTGCGGCCGAGGCAACCAATCTGAATAGGGCGACAGCCACAAACAAGGAAACTCGGTCCAGGGATAAG
CAACAGGAGCCTCCTCTACAGGAACGCATGCTAGAATACGTCCGCTGGATGGTTCTTCATCACCATGGCTTCGTG
GCTGCCTTTATGTCGTGCATTCGTCATGCGCCTCTGCTGGATGAGTCGGAGAGCTGGAGGCTCCTGGCCCGTCGC
CCTCCTGGATCTACCGCTGTTTTGCTCGCCGACGCTGACGAAATTATCAATGCCGACCATTACACTAGCCATGGC
CTGGCTCTAGTGGGCGGACCAGATCGTGTCGTATGGCGTGTGCTTCCAGGCAGCCACGACTTCGTCATGACGCAT
GTTGAGTCTGTCATGGGGGTACTTGATGACTTTTGGGACATGAAGAAGCTTGGCTAG
Transcript >OphauB2|6352
ATGGCCTTGGCGATACCATGGCCCTTGTCAACAGCAGCGCTCGTGGCGGCAACAGCCCTGGCGACAACGGCTTTG
CTGGTGCTGGCGCGCACAGCTCTCTGGCCAAGACGCAGGCGCGTGCTGCCAAGTCCGCTGCACACATTGGCCGAG
ACCAAGGAGCCGAGAATGCGCCTGGGCAGCTGGTTATACCCGACGGATGCCTTTCCTGGAGGCCGTGACGTCGAG
ACACCATACGGCTCGATGCGCGTCTACGAATTCGGCCCTCAAGACGGACCAAAGGTGCTTTTTGTGCATGGCATC
AGTACACCTTGTATGACACTATCCCTGCTTGCTCAGGCCTGTGTTGCCCGTGGCTGCCGCGTCATGCTATTTGAT
CTCTTTGGCCGTGGCTATTCCGATGGTGTTGGCGATCTTCCCCACGATGCCCGTCTTTACTCGTCGCAGATACTG
TGCGCCCTTGCCTCGAGCCCGCTGCCCTGGACGGGATCTCAGGCACGACTGCGCCTGGTTGGTTATTCCATGGGC
GGCTCTCTGGCAGTCTGCTTCGCCAATGCCTTCCCCGACCTTGTCGCCTCGCTCGTCCTCATGGCCCCGGCAGGA
TTGATTCGGCCCACCGACTTTGGCACCCTGTCTCGTATCCTCTTCCGTTCTGGCCTGCTGCCCGATCGCATTGTT
ACTGTCCTTGCCCGACGGCGCTTGCAGGCTCCCATTGTTGCCTCTCGCCTCTCGCCCAAGGCCATGGCGGCAGCC
ACCCTGGCTGCGGCCGAGGCAACCAATCTGAATAGGGCGACAGCCACAAACAAGGAAACTCGGTCCAGGGATAAG
CAACAGGAGCCTCCTCTACAGGAACGCATGCTAGAATACGTCCGCTGGATGGTTCTTCATCACCATGGCTTCGTG
GCTGCCTTTATGTCGTGCATTCGTCATGCGCCTCTGCTGGATGAGTCGGAGAGCTGGAGGCTCCTGGCCCGTCGC
CCTCCTGGATCTACCGCTGTTTTGCTCGCCGACGCTGACGAAATTATCAATGCCGACCATTACACTAGCCATGGC
CTGGCTCTAGTGGGCGGACCAGATCGTGTCGTATGGCGTGTGCTTCCAGGCAGCCACGACTTCGTCATGACGCAT
GTTGAGTCTGTCATGGGGGTACTTGATGACTTTTGGGACATGAAGAAGCTTGGCTAG
Gene >OphauB2|6352
ATGGCCTTGGCGATACCATGGCCCTTGTCAACAGCAGCGCTCGTGGCGGCAACAGCCCTGGCGACAACGGCTTTG
CTGGTGCTGGCGCGCACAGCTCTCTGGCCAAGACGCAGGCGCGTGCTGCCAAGTCCGCTGCACACATTGGCCGAG
ACCAAGGAGCCGAGAATGCGCCTGGGCAGCTGGTTATACCCGACGGATGCCTTTCCTGGAGGCCGTGACGTCGAG
ACACCAGTCAGCTTCCTGAGCTCAAGTCGGTGCGCCACAGACGAGGCACTGCTGACAGCACCATGATTAAACAGT
ACGGCTCGATGCGCGTCTACGAATTCGGCCCTCAAGACGGACCAAAGGTGCTTTTTGTGCATGGCATCAGTACAC
CTTGTATGACACTATCCCTGCTTGCTCAGGCCTGTGTTGCCCGTGGCTGCCGCGTCATGCTATTTGTACGTCACG
TCTGCCTGCTGCCTGCCAGAGTGGCCGCTAATTGGATGATGCAACAGGATCTCTTTGGCCGTGGCTATTCCGATG
GTGTTGGCGATCTTCCCCACGATGCCCGTCTTTACTCGTCGCAGATACTGTGCGCCCTTGCCTCGAGCCCGCTGC
CCTGGACGGGATCTCAGGCACGACTGCGCCTGGTTGGTTATTCCATGGGCGGCTCTCTGGCAGTCTGCTTCGCCA
ATGCCTTCCCCGACCTTGTCGCCTCGCTCGTCCTCATGGCCCCGGCAGGATTGATTCGGCCCACCGACTTTGGCA
CCCTGTCTCGTATCCTCTTCCGTTCTGGCCTGCTGCCCGATCGCATTGTTACTGTCCTTGCCCGACGGCGCTTGC
AGGCTCCCATTGTTGCCTCTCGCCTCTCGCCCAAGGCCATGGCGGCAGCCACCCTGGCTGCGGCCGAGGCAACCA
ATCTGAATAGGGCGACAGCCACAAACAAGGAAACTCGGTCCAGGGATAAGCAACAGGAGCCTCCTCTACAGGAAC
GCATGCTAGAATACGTCCGCTGGATGGTTCTTCATCACCATGGCTTCGTGGCTGCCTTTATGTCGTGCATTCGTC
ATGCGCCTCTGCTGGATGAGTCGGAGAGCTGGAGGCTCCTGGCCCGTCGCCCTCCTGGATCTACCGCTGTTTTGC
TCGCCGACGCTGACGAAATTATCAATGCCGACCATTACACTAGCCATGGCCTGGCTCTAGTGGGCGGACCAGATC
GTGTCGTATGGCGTGTGCTTCCAGGCAGCCACGACTTCGTCATGACGCATGTTGAGTCTGTCATGGGGGTACTTG
ATGACTTTTGGGACATGAAGAAGCTTGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail