Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6345
Gene name
LocationContig_58:20062..21237
Strand+
Gene length (bp)1175
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00231 ATP-synt ATP synthase 4.2E-79 31 300

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49377|ATPG_KLULA ATP synthase subunit gamma, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP3 PE=1 SV=1 25 300 5.0E-87
sp|P38077|ATPG_YEAST ATP synthase subunit gamma, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP3 PE=1 SV=1 29 300 3.0E-86
sp|O74754|ATPG_SCHPO ATP synthase subunit gamma, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp3 PE=3 SV=1 1 300 5.0E-85
sp|O01666|ATPG_DROME ATP synthase subunit gamma, mitochondrial OS=Drosophila melanogaster GN=ATPsyngamma PE=2 SV=2 28 300 4.0E-69
sp|P05631|ATPG_BOVIN ATP synthase subunit gamma, mitochondrial OS=Bos taurus GN=ATP5C1 PE=1 SV=3 1 300 9.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49377|ATPG_KLULA ATP synthase subunit gamma, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP3 PE=1 SV=1 25 300 5.0E-87
sp|P38077|ATPG_YEAST ATP synthase subunit gamma, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP3 PE=1 SV=1 29 300 3.0E-86
sp|O74754|ATPG_SCHPO ATP synthase subunit gamma, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp3 PE=3 SV=1 1 300 5.0E-85
sp|O01666|ATPG_DROME ATP synthase subunit gamma, mitochondrial OS=Drosophila melanogaster GN=ATPsyngamma PE=2 SV=2 28 300 4.0E-69
sp|P05631|ATPG_BOVIN ATP synthase subunit gamma, mitochondrial OS=Bos taurus GN=ATP5C1 PE=1 SV=3 1 300 9.0E-69
sp|Q91VR2|ATPG_MOUSE ATP synthase subunit gamma, mitochondrial OS=Mus musculus GN=Atp5c1 PE=1 SV=1 6 300 5.0E-67
sp|P36542|ATPG_HUMAN ATP synthase subunit gamma, mitochondrial OS=Homo sapiens GN=ATP5C1 PE=1 SV=1 11 300 9.0E-67
sp|P35435|ATPG_RAT ATP synthase subunit gamma, mitochondrial OS=Rattus norvegicus GN=Atp5c1 PE=1 SV=2 30 300 1.0E-66
sp|Q5RBS9|ATPG_PONAB ATP synthase subunit gamma, mitochondrial OS=Pongo abelii GN=ATP5C1 PE=2 SV=1 11 300 2.0E-66
sp|Q4R5B0|ATPG_MACFA ATP synthase subunit gamma, mitochondrial OS=Macaca fascicularis GN=ATP5C1 PE=2 SV=1 11 300 2.0E-66
sp|P26360|ATPG3_IPOBA ATP synthase subunit gamma, mitochondrial OS=Ipomoea batatas GN=ATPC PE=1 SV=2 6 302 2.0E-45
sp|Q96250|ATPG3_ARATH ATP synthase subunit gamma, mitochondrial OS=Arabidopsis thaliana GN=ATPC PE=2 SV=1 6 302 4.0E-43
sp|B6IPC7|ATPG_RHOCS ATP synthase gamma chain OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=atpG PE=3 SV=1 31 300 5.0E-40
sp|Q2VZN1|ATPG_MAGSA ATP synthase gamma chain OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=atpG PE=3 SV=1 30 300 2.0E-39
sp|Q1GEU7|ATPG_RUEST ATP synthase gamma chain OS=Ruegeria sp. (strain TM1040) GN=atpG PE=3 SV=1 31 300 6.0E-39
sp|Q162S8|ATPG_ROSDO ATP synthase gamma chain OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=atpG PE=3 SV=1 31 300 6.0E-39
sp|Q4FP37|ATPG_PELUB ATP synthase gamma chain OS=Pelagibacter ubique (strain HTCC1062) GN=atpG PE=3 SV=1 30 298 4.0E-36
sp|Q5LNP0|ATPG_RUEPO ATP synthase gamma chain OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=atpG PE=3 SV=1 32 300 1.0E-35
sp|P05436|ATPG_RHOBL ATP synthase gamma chain OS=Rhodobacter blasticus GN=atpG PE=3 SV=1 31 300 1.0E-35
sp|B2ICI6|ATPG_BEII9 ATP synthase gamma chain OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=atpG PE=3 SV=1 31 300 4.0E-35
sp|P07227|ATPG_RHORU ATP synthase gamma chain OS=Rhodospirillum rubrum GN=atpG PE=3 SV=1 30 300 1.0E-34
sp|Q2RV19|ATPG_RHORT ATP synthase gamma chain OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=atpG PE=3 SV=1 30 300 1.0E-34
sp|B8FZ35|ATPG_DESHD ATP synthase gamma chain OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=atpG PE=3 SV=1 30 302 2.0E-34
sp|Q28TJ7|ATPG_JANSC ATP synthase gamma chain OS=Jannaschia sp. (strain CCS1) GN=atpG PE=3 SV=1 32 300 4.0E-34
sp|B9LZ85|ATPG_GEODF ATP synthase gamma chain OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=atpG PE=3 SV=1 30 298 4.0E-34
sp|B8IN02|ATPG_METNO ATP synthase gamma chain OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=atpG PE=3 SV=1 30 300 4.0E-34
sp|B1I6J8|ATPG_DESAP ATP synthase gamma chain OS=Desulforudis audaxviator (strain MP104C) GN=atpG PE=3 SV=1 32 302 5.0E-34
sp|Q5NQZ0|ATPG_ZYMMO ATP synthase gamma chain OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=atpG PE=3 SV=1 31 300 6.0E-34
sp|B3EA02|ATPG_GEOLS ATP synthase gamma chain OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=atpG PE=3 SV=1 30 298 7.0E-34
sp|B0THN3|ATPG_HELMI ATP synthase gamma chain OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=atpG PE=3 SV=1 32 300 1.0E-33
sp|Q07VU3|ATPG_SHEFN ATP synthase gamma chain OS=Shewanella frigidimarina (strain NCIMB 400) GN=atpG PE=3 SV=1 30 300 2.0E-33
sp|A5V3X4|ATPG_SPHWW ATP synthase gamma chain OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=atpG PE=3 SV=1 30 300 4.0E-33
sp|B2J059|ATPG_NOSP7 ATP synthase gamma chain OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=atpG PE=3 SV=1 30 300 6.0E-33
sp|B0UE40|ATPG_METS4 ATP synthase gamma chain OS=Methylobacterium sp. (strain 4-46) GN=atpG PE=3 SV=1 31 300 6.0E-33
sp|A1B8N9|ATPG_PARDP ATP synthase gamma chain OS=Paracoccus denitrificans (strain Pd 1222) GN=atpG PE=1 SV=1 31 300 6.0E-33
sp|A8LJR5|ATPG_DINSH ATP synthase gamma chain OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=atpG PE=3 SV=1 32 300 1.0E-32
sp|Q54DF1|ATPG_DICDI ATP synthase subunit gamma, mitochondrial OS=Dictyostelium discoideum GN=atp5C1 PE=1 SV=1 16 302 1.0E-32
sp|A5CYE3|ATPG_PELTS ATP synthase gamma chain OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=atpG PE=3 SV=1 31 302 2.0E-32
sp|Q74GY1|ATPG_GEOSL ATP synthase gamma chain OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=atpG PE=3 SV=1 30 298 2.0E-32
sp|Q0BQE7|ATPG_GRABC ATP synthase gamma chain OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=atpG PE=3 SV=1 30 300 2.0E-32
sp|Q5X0P2|ATPG_LEGPA ATP synthase gamma chain OS=Legionella pneumophila (strain Paris) GN=atpG PE=3 SV=1 30 300 4.0E-32
sp|Q5WSG7|ATPG_LEGPL ATP synthase gamma chain OS=Legionella pneumophila (strain Lens) GN=atpG PE=3 SV=1 30 300 4.0E-32
sp|Q5ZRA0|ATPG_LEGPH ATP synthase gamma chain OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=atpG PE=3 SV=1 30 300 4.0E-32
sp|A5III4|ATPG_LEGPC ATP synthase gamma chain OS=Legionella pneumophila (strain Corby) GN=atpG PE=3 SV=1 30 300 4.0E-32
sp|A5G9D7|ATPG_GEOUR ATP synthase gamma chain OS=Geobacter uraniireducens (strain Rf4) GN=atpG PE=3 SV=1 30 298 6.0E-32
sp|A1RQB1|ATPG_SHESW ATP synthase gamma chain OS=Shewanella sp. (strain W3-18-1) GN=atpG PE=3 SV=1 33 300 1.0E-31
sp|A4YCH9|ATPG_SHEPC ATP synthase gamma chain OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=atpG PE=3 SV=1 33 300 1.0E-31
sp|Q3A945|ATPG_CARHZ ATP synthase gamma chain OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=atpG PE=3 SV=1 31 302 1.0E-31
sp|A1AXU3|ATPG_RUTMC ATP synthase gamma chain OS=Ruthia magnifica subsp. Calyptogena magnifica GN=atpG PE=3 SV=1 33 300 1.0E-31
sp|Q0A4M7|ATPG_ALKEH ATP synthase gamma chain OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=atpG PE=3 SV=1 33 300 2.0E-31
sp|Q21CY6|ATPG_RHOPB ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain BisB18) GN=atpG PE=3 SV=1 30 300 2.0E-31
sp|A7HT51|ATPG_PARL1 ATP synthase gamma chain OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=atpG PE=3 SV=1 30 300 2.0E-31
sp|Q39Q55|ATPG_GEOMG ATP synthase gamma chain OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=atpG PE=3 SV=1 30 298 2.0E-31
sp|Q1Q898|ATPG_PSYCK ATP synthase gamma chain OS=Psychrobacter cryohalolentis (strain K5) GN=atpG PE=3 SV=1 30 300 3.0E-31
sp|Q3M9W1|ATPG_ANAVT ATP synthase gamma chain OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=atpG PE=3 SV=1 32 300 3.0E-31
sp|Q1CX34|ATPG_MYXXD ATP synthase gamma chain OS=Myxococcus xanthus (strain DK 1622) GN=atpG PE=3 SV=1 30 300 3.0E-31
sp|A5FZ53|ATPG_ACICJ ATP synthase gamma chain OS=Acidiphilium cryptum (strain JF-5) GN=atpG PE=3 SV=1 30 300 3.0E-31
sp|A4J9A0|ATPG_DESRM ATP synthase gamma chain OS=Desulfotomaculum reducens (strain MI-1) GN=atpG PE=3 SV=1 30 302 3.0E-31
sp|C5BF39|ATPG_EDWI9 ATP synthase gamma chain OS=Edwardsiella ictaluri (strain 93-146) GN=atpG PE=3 SV=1 33 300 4.0E-31
sp|B6J2D9|ATPG_COXB2 ATP synthase gamma chain OS=Coxiella burnetii (strain CbuG_Q212) GN=atpG PE=3 SV=1 33 302 4.0E-31
sp|P20602|ATPG_BACMQ ATP synthase gamma chain OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=atpG PE=3 SV=1 30 302 4.0E-31
sp|Q6LKZ7|ATPG2_PHOPR ATP synthase gamma chain 2 OS=Photobacterium profundum GN=atpG2 PE=3 SV=1 30 300 4.0E-31
sp|Q83AF6|ATPG_COXBU ATP synthase gamma chain OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=atpG PE=3 SV=1 33 302 5.0E-31
sp|A9NBC9|ATPG_COXBR ATP synthase gamma chain OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=atpG PE=3 SV=1 33 302 5.0E-31
sp|A9KBF8|ATPG_COXBN ATP synthase gamma chain OS=Coxiella burnetii (strain Dugway 5J108-111) GN=atpG PE=3 SV=1 33 302 5.0E-31
sp|A7IH30|ATPG_XANP2 ATP synthase gamma chain OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=atpG PE=3 SV=1 30 300 5.0E-31
sp|P72246|ATPG_RHOCA ATP synthase gamma chain OS=Rhodobacter capsulatus GN=atpG PE=1 SV=3 31 300 5.0E-31
sp|B4F0E6|ATPG_PROMH ATP synthase gamma chain OS=Proteus mirabilis (strain HI4320) GN=atpG PE=3 SV=1 33 300 6.0E-31
sp|Q8VV78|ATPG_COLMA ATP synthase gamma chain OS=Colwellia maris GN=atpG PE=3 SV=1 30 300 6.0E-31
sp|Q82XP9|ATPG_NITEU ATP synthase gamma chain OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=atpG PE=3 SV=1 33 300 7.0E-31
sp|Q2J3I3|ATPG_RHOP2 ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain HaA2) GN=atpG PE=3 SV=1 30 300 7.0E-31
sp|B6J962|ATPG_COXB1 ATP synthase gamma chain OS=Coxiella burnetii (strain CbuK_Q154) GN=atpG PE=3 SV=1 33 302 8.0E-31
sp|Q7NA93|ATPG_PHOLL ATP synthase gamma chain OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=atpG PE=3 SV=1 33 300 8.0E-31
sp|A8HS13|ATPG_AZOC5 ATP synthase gamma chain OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=atpG PE=3 SV=1 30 300 8.0E-31
sp|A0L2S9|ATPG_SHESA ATP synthase gamma chain OS=Shewanella sp. (strain ANA-3) GN=atpG PE=3 SV=1 33 300 9.0E-31
sp|Q13DP3|ATPG_RHOPS ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain BisB5) GN=atpG PE=3 SV=1 30 300 1.0E-30
sp|A9KX07|ATPG_SHEB9 ATP synthase gamma chain OS=Shewanella baltica (strain OS195) GN=atpG PE=3 SV=1 30 300 1.0E-30
sp|A6WUJ1|ATPG_SHEB8 ATP synthase gamma chain OS=Shewanella baltica (strain OS185) GN=atpG PE=3 SV=1 30 300 1.0E-30
sp|A3DAR5|ATPG_SHEB5 ATP synthase gamma chain OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=atpG PE=3 SV=1 30 300 1.0E-30
sp|B8EDV1|ATPG_SHEB2 ATP synthase gamma chain OS=Shewanella baltica (strain OS223) GN=atpG PE=3 SV=1 30 300 1.0E-30
sp|Q2N8Z4|ATPG_ERYLH ATP synthase gamma chain OS=Erythrobacter litoralis (strain HTCC2594) GN=atpG PE=3 SV=1 30 300 1.0E-30
sp|Q6CYJ4|ATPG_PECAS ATP synthase gamma chain OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=atpG PE=3 SV=1 33 300 2.0E-30
sp|P05435|ATPG_SPIOL ATP synthase gamma chain, chloroplastic OS=Spinacia oleracea GN=ATPC PE=1 SV=2 10 300 2.0E-30
sp|Q0SQZ4|ATPG_CLOPS ATP synthase gamma chain OS=Clostridium perfringens (strain SM101 / Type A) GN=atpG PE=3 SV=1 30 300 2.0E-30
sp|Q8XID3|ATPG_CLOPE ATP synthase gamma chain OS=Clostridium perfringens (strain 13 / Type A) GN=atpG PE=3 SV=1 30 300 2.0E-30
sp|Q0TNC3|ATPG_CLOP1 ATP synthase gamma chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=atpG PE=3 SV=1 30 300 2.0E-30
sp|A8G7M7|ATPG_SERP5 ATP synthase gamma chain OS=Serratia proteamaculans (strain 568) GN=atpG PE=3 SV=1 33 300 2.0E-30
sp|B6EHG5|ATPG_ALISL ATP synthase gamma chain OS=Aliivibrio salmonicida (strain LFI1238) GN=atpG PE=3 SV=1 30 300 2.0E-30
sp|Q3SVJ3|ATPG_NITWN ATP synthase gamma chain OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=atpG PE=3 SV=1 30 300 2.0E-30
sp|Q2G5N6|ATPG_NOVAD ATP synthase gamma chain OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atpG PE=3 SV=1 30 300 2.0E-30
sp|Q0HPG0|ATPG_SHESR ATP synthase gamma chain OS=Shewanella sp. (strain MR-7) GN=atpG PE=3 SV=1 30 300 3.0E-30
sp|Q0HD78|ATPG_SHESM ATP synthase gamma chain OS=Shewanella sp. (strain MR-4) GN=atpG PE=3 SV=1 30 300 3.0E-30
sp|B2VCA5|ATPG_ERWT9 ATP synthase gamma chain OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=atpG PE=3 SV=1 30 300 3.0E-30
sp|P08450|ATPG_SYNP6 ATP synthase gamma chain OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=atpG PE=3 SV=2 30 300 3.0E-30
sp|O05432|ATPG_MOOTA ATP synthase gamma chain OS=Moorella thermoacetica (strain ATCC 39073) GN=atpG PE=1 SV=2 30 300 3.0E-30
sp|Q5FRC6|ATPG_GLUOX ATP synthase gamma chain OS=Gluconobacter oxydans (strain 621H) GN=atpG PE=3 SV=1 30 300 4.0E-30
sp|A9H9A6|ATPG_GLUDA ATP synthase gamma chain OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpG PE=3 SV=1 30 300 4.0E-30
sp|B4SJS0|ATPG_STRM5 ATP synthase gamma chain OS=Stenotrophomonas maltophilia (strain R551-3) GN=atpG PE=3 SV=1 30 300 4.0E-30
sp|P12408|ATPG_NOSS1 ATP synthase gamma chain OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=atpG PE=3 SV=2 32 300 5.0E-30
sp|Q11DD6|ATPG_CHESB ATP synthase gamma chain OS=Chelativorans sp. (strain BNC1) GN=atpG PE=3 SV=1 31 300 6.0E-30
sp|B4RD46|ATPG_PHEZH ATP synthase gamma chain OS=Phenylobacterium zucineum (strain HLK1) GN=atpG PE=3 SV=1 30 300 6.0E-30
sp|Q5E1N6|ATPG_VIBF1 ATP synthase gamma chain OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=atpG PE=3 SV=1 30 300 6.0E-30
sp|B9KPI7|ATPG_RHOSK ATP synthase gamma chain OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=atpG PE=3 SV=1 31 300 7.0E-30
sp|A3PIB8|ATPG_RHOS1 ATP synthase gamma chain OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=atpG PE=3 SV=1 31 300 7.0E-30
sp|Q4FQ36|ATPG_PSYA2 ATP synthase gamma chain OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=atpG PE=3 SV=1 30 300 7.0E-30
sp|B5FCZ2|ATPG_VIBFM ATP synthase gamma chain OS=Vibrio fischeri (strain MJ11) GN=atpG PE=3 SV=1 30 300 8.0E-30
sp|Q05384|ATPG_SYNP1 ATP synthase gamma chain OS=Synechococcus sp. (strain PCC 6716) GN=atpG PE=3 SV=1 32 300 9.0E-30
sp|A4WUM8|ATPG_RHOS5 ATP synthase gamma chain OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=atpG PE=3 SV=1 31 300 1.0E-29
sp|A7MMX0|ATPG_CROS8 ATP synthase gamma chain OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=atpG PE=3 SV=1 33 300 1.0E-29
sp|Q31RF0|ATPG_SYNE7 ATP synthase gamma chain OS=Synechococcus elongatus (strain PCC 7942) GN=atpG PE=3 SV=1 30 300 1.0E-29
sp|Q8E8B9|ATPG_SHEON ATP synthase gamma chain OS=Shewanella oneidensis (strain MR-1) GN=atpG PE=3 SV=1 30 300 1.0E-29
sp|B8F773|ATPG_HAEPS ATP synthase gamma chain OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=atpG PE=3 SV=1 33 300 1.0E-29
sp|Q0AJB1|ATPG_NITEC ATP synthase gamma chain OS=Nitrosomonas eutropha (strain C91) GN=atpG PE=3 SV=1 30 300 2.0E-29
sp|A4SUT3|ATPG_POLSQ ATP synthase gamma chain OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=atpG PE=3 SV=1 30 300 2.0E-29
sp|Q9L6B6|ATPG_PASMU ATP synthase gamma chain OS=Pasteurella multocida (strain Pm70) GN=atpG PE=3 SV=1 33 300 2.0E-29
sp|Q1QQS6|ATPG_NITHX ATP synthase gamma chain OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=atpG PE=3 SV=1 30 300 2.0E-29
sp|Q12HQ0|ATPG_SHEDO ATP synthase gamma chain OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=atpG PE=3 SV=1 30 300 2.0E-29
sp|A1SBU1|ATPG_SHEAM ATP synthase gamma chain OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=atpG PE=3 SV=1 33 300 2.0E-29
sp|Q3SF65|ATPG_THIDA ATP synthase gamma chain OS=Thiobacillus denitrificans (strain ATCC 25259) GN=atpG PE=3 SV=1 33 300 2.0E-29
sp|P29710|ATPG_PROMO ATP synthase gamma chain, sodium ion specific OS=Propionigenium modestum GN=atpG PE=1 SV=2 33 300 2.0E-29
sp|Q4K3A8|ATPG_PSEF5 ATP synthase gamma chain OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=atpG PE=3 SV=1 30 300 3.0E-29
sp|Q3J432|ATPG_RHOS4 ATP synthase gamma chain OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=atpG PE=3 SV=1 31 300 3.0E-29
sp|Q89X73|ATPG_BRADU ATP synthase gamma chain OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=atpG PE=3 SV=1 30 300 3.0E-29
sp|B7KUA3|ATPG_METC4 ATP synthase gamma chain OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=atpG PE=3 SV=1 31 300 3.0E-29
sp|B2FHY9|ATPG_STRMK ATP synthase gamma chain OS=Stenotrophomonas maltophilia (strain K279a) GN=atpG PE=3 SV=1 30 300 3.0E-29
sp|Q01909|ATPG2_ARATH ATP synthase gamma chain 2, chloroplastic OS=Arabidopsis thaliana GN=ATPC2 PE=2 SV=1 30 300 3.0E-29
sp|Q3J6N0|ATPG_NITOC ATP synthase gamma chain OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=atpG PE=3 SV=1 30 300 3.0E-29
sp|Q2YCA4|ATPG_NITMU ATP synthase gamma chain OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=atpG PE=3 SV=1 33 300 4.0E-29
sp|Q07UZ4|ATPG_RHOP5 ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain BisA53) GN=atpG PE=3 SV=1 30 300 4.0E-29
sp|B0TQF5|ATPG_SHEHH ATP synthase gamma chain OS=Shewanella halifaxensis (strain HAW-EB4) GN=atpG PE=3 SV=1 30 300 4.0E-29
sp|C6E9F2|ATPG_GEOSM ATP synthase gamma chain OS=Geobacter sp. (strain M21) GN=atpG PE=3 SV=1 30 298 4.0E-29
sp|Q3YVN7|ATPG_SHISS ATP synthase gamma chain OS=Shigella sonnei (strain Ss046) GN=atpG PE=3 SV=1 33 300 5.0E-29
sp|A4WGF4|ATPG_ENT38 ATP synthase gamma chain OS=Enterobacter sp. (strain 638) GN=atpG PE=3 SV=1 33 300 6.0E-29
sp|B8HPK2|ATPG_CYAP4 ATP synthase gamma chain OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=atpG PE=3 SV=1 30 300 6.0E-29
sp|A6TG37|ATPG_KLEP7 ATP synthase gamma chain OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=atpG PE=3 SV=1 33 300 6.0E-29
sp|Q88BX3|ATPG_PSEPK ATP synthase gamma chain OS=Pseudomonas putida (strain KT2440) GN=atpG PE=3 SV=1 30 300 6.0E-29
sp|A5WBA4|ATPG_PSEP1 ATP synthase gamma chain OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpG PE=3 SV=1 30 300 6.0E-29
sp|Q15MU3|ATPG_PSEA6 ATP synthase gamma chain OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=atpG PE=3 SV=1 30 300 6.0E-29
sp|A4STP4|ATPG_AERS4 ATP synthase gamma chain OS=Aeromonas salmonicida (strain A449) GN=atpG PE=3 SV=1 30 300 6.0E-29
sp|B7L880|ATPG_ECO55 ATP synthase gamma chain OS=Escherichia coli (strain 55989 / EAEC) GN=atpG PE=3 SV=1 33 300 7.0E-29
sp|A7ZTU5|ATPG_ECO24 ATP synthase gamma chain OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=atpG PE=3 SV=1 33 300 7.0E-29
sp|B1XSD3|ATPG_POLNS ATP synthase gamma chain OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=atpG PE=3 SV=1 30 300 7.0E-29
sp|C0Z777|ATPG_BREBN ATP synthase gamma chain OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=atpG PE=3 SV=1 32 300 7.0E-29
sp|P0ABA9|ATPG_SHIFL ATP synthase gamma chain OS=Shigella flexneri GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|Q0SYU3|ATPG_SHIF8 ATP synthase gamma chain OS=Shigella flexneri serotype 5b (strain 8401) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|Q329S2|ATPG_SHIDS ATP synthase gamma chain OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B2TUP2|ATPG_SHIB3 ATP synthase gamma chain OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B7LK78|ATPG_ESCF3 ATP synthase gamma chain OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|Q1R4K1|ATPG_ECOUT ATP synthase gamma chain OS=Escherichia coli (strain UTI89 / UPEC) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B1LL60|ATPG_ECOSM ATP synthase gamma chain OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B6I3X0|ATPG_ECOSE ATP synthase gamma chain OS=Escherichia coli (strain SE11) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B7NF49|ATPG_ECOLU ATP synthase gamma chain OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|P0ABA6|ATPG_ECOLI ATP synthase gamma chain OS=Escherichia coli (strain K12) GN=atpG PE=1 SV=1 33 300 8.0E-29
sp|B1IX05|ATPG_ECOLC ATP synthase gamma chain OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|P0ABA7|ATPG_ECOL6 ATP synthase gamma chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|Q0TAX6|ATPG_ECOL5 ATP synthase gamma chain OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|A1AHR5|ATPG_ECOK1 ATP synthase gamma chain OS=Escherichia coli O1:K1 / APEC GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|A8A6J6|ATPG_ECOHS ATP synthase gamma chain OS=Escherichia coli O9:H4 (strain HS) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B1X9W1|ATPG_ECODH ATP synthase gamma chain OS=Escherichia coli (strain K12 / DH10B) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|C4ZZ11|ATPG_ECOBW ATP synthase gamma chain OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B7M589|ATPG_ECO8A ATP synthase gamma chain OS=Escherichia coli O8 (strain IAI1) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B7N2H2|ATPG_ECO81 ATP synthase gamma chain OS=Escherichia coli O81 (strain ED1a) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B7NR35|ATPG_ECO7I ATP synthase gamma chain OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B5YXD7|ATPG_ECO5E ATP synthase gamma chain OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|P0ABA8|ATPG_ECO57 ATP synthase gamma chain OS=Escherichia coli O157:H7 GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B7MGF3|ATPG_ECO45 ATP synthase gamma chain OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|B7UMJ8|ATPG_ECO27 ATP synthase gamma chain OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|C6DJH1|ATPG_PECCP ATP synthase gamma chain OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=atpG PE=3 SV=1 33 300 8.0E-29
sp|Q8DLU1|ATPG_THEEB ATP synthase gamma chain OS=Thermosynechococcus elongatus (strain BP-1) GN=atpG PE=1 SV=1 30 300 8.0E-29
sp|A8G1W6|ATPG_SHESH ATP synthase gamma chain OS=Shewanella sediminis (strain HAW-EB3) GN=atpG PE=3 SV=1 30 300 9.0E-29
sp|A1W2T6|ATPG_ACISJ ATP synthase gamma chain OS=Acidovorax sp. (strain JS42) GN=atpG PE=3 SV=1 33 300 9.0E-29
sp|B9MBA2|ATPG_ACIET ATP synthase gamma chain OS=Acidovorax ebreus (strain TPSY) GN=atpG PE=3 SV=1 33 300 9.0E-29
sp|A1JTC7|ATPG_YERE8 ATP synthase gamma chain OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=atpG PE=3 SV=1 33 300 1.0E-28
sp|Q4ZL23|ATPG_PSEU2 ATP synthase gamma chain OS=Pseudomonas syringae pv. syringae (strain B728a) GN=atpG PE=3 SV=1 30 300 1.0E-28
sp|Q48BG4|ATPG_PSE14 ATP synthase gamma chain OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=atpG PE=3 SV=1 30 300 1.0E-28
sp|B3Q746|ATPG_RHOPT ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain TIE-1) GN=atpG PE=3 SV=1 30 300 1.0E-28
sp|Q6NDD1|ATPG_RHOPA ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=atpG PE=3 SV=1 30 300 1.0E-28
sp|B5XZM3|ATPG_KLEP3 ATP synthase gamma chain OS=Klebsiella pneumoniae (strain 342) GN=atpG PE=3 SV=1 33 300 1.0E-28
sp|Q87TT3|ATPG_PSESM ATP synthase gamma chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=atpG PE=3 SV=1 33 300 1.0E-28
sp|Q2IHQ1|ATPG_ANADE ATP synthase gamma chain OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=atpG PE=3 SV=1 31 300 1.0E-28
sp|B0KRA9|ATPG_PSEPG ATP synthase gamma chain OS=Pseudomonas putida (strain GB-1) GN=atpG PE=3 SV=1 30 300 1.0E-28
sp|A8HAG4|ATPG_SHEPA ATP synthase gamma chain OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=atpG PE=3 SV=1 30 300 1.0E-28
sp|Q01908|ATPG1_ARATH ATP synthase gamma chain 1, chloroplastic OS=Arabidopsis thaliana GN=ATPC1 PE=1 SV=1 7 300 1.0E-28
sp|A6W3S9|ATPG_MARMS ATP synthase gamma chain OS=Marinomonas sp. (strain MWYL1) GN=atpG PE=3 SV=1 30 300 1.0E-28
sp|Q6LLG7|ATPG1_PHOPR ATP synthase gamma chain 1 OS=Photobacterium profundum GN=atpG1 PE=3 SV=1 30 300 2.0E-28
sp|Q48AW1|ATPG_COLP3 ATP synthase gamma chain OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|B1KQ35|ATPG_SHEWM ATP synthase gamma chain OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|B1JFU2|ATPG_PSEPW ATP synthase gamma chain OS=Pseudomonas putida (strain W619) GN=atpG PE=3 SV=1 33 300 2.0E-28
sp|Q9A2V8|ATPG_CAUCR ATP synthase gamma chain OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|B8H5I1|ATPG_CAUCN ATP synthase gamma chain OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|Q65Q06|ATPG_MANSM ATP synthase gamma chain OS=Mannheimia succiniciproducens (strain MBEL55E) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|B5EFI8|ATPG_GEOBB ATP synthase gamma chain OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=atpG PE=3 SV=1 30 298 2.0E-28
sp|B5ER43|ATPG_ACIF5 ATP synthase gamma chain OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|B7JB85|ATPG_ACIF2 ATP synthase gamma chain OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|Q3ZZT8|ATPG_DEHMC ATP synthase gamma chain OS=Dehalococcoides mccartyi (strain CBDB1) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|C3K1E7|ATPG_PSEFS ATP synthase gamma chain OS=Pseudomonas fluorescens (strain SBW25) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|Q31UN3|ATPG_SHIBS ATP synthase gamma chain OS=Shigella boydii serotype 4 (strain Sb227) GN=atpG PE=3 SV=1 33 300 2.0E-28
sp|B8GRB9|ATPG_THISH ATP synthase gamma chain OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=atpG PE=3 SV=1 33 300 2.0E-28
sp|Q7VQV7|ATPG_BLOFL ATP synthase gamma chain OS=Blochmannia floridanus GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|B1JRN1|ATPG_YERPY ATP synthase gamma chain OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|Q663Q7|ATPG_YERPS ATP synthase gamma chain OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|A4TSJ2|ATPG_YERPP ATP synthase gamma chain OS=Yersinia pestis (strain Pestoides F) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|Q1CCH4|ATPG_YERPN ATP synthase gamma chain OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|A9R5U0|ATPG_YERPG ATP synthase gamma chain OS=Yersinia pestis bv. Antiqua (strain Angola) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|Q8Z9S5|ATPG_YERPE ATP synthase gamma chain OS=Yersinia pestis GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|B2K846|ATPG_YERPB ATP synthase gamma chain OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|Q1C094|ATPG_YERPA ATP synthase gamma chain OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|A7FPE1|ATPG_YERP3 ATP synthase gamma chain OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=atpG PE=3 SV=1 30 300 2.0E-28
sp|A9BPU6|ATPG_DELAS ATP synthase gamma chain OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=atpG PE=3 SV=1 33 300 2.0E-28
sp|A5UGZ0|ATPG_HAEIG ATP synthase gamma chain OS=Haemophilus influenzae (strain PittGG) GN=atpG PE=3 SV=1 33 300 3.0E-28
sp|A7HIX8|ATPG_ANADF ATP synthase gamma chain OS=Anaeromyxobacter sp. (strain Fw109-5) GN=atpG PE=3 SV=1 31 300 3.0E-28
sp|A3QJR1|ATPG_SHELP ATP synthase gamma chain OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=atpG PE=3 SV=1 30 300 3.0E-28
sp|A5WBW0|ATPG_PSYWF ATP synthase gamma chain OS=Psychrobacter sp. (strain PRwf-1) GN=atpG PE=3 SV=1 30 300 3.0E-28
sp|Q1I2I6|ATPG_PSEE4 ATP synthase gamma chain OS=Pseudomonas entomophila (strain L48) GN=atpG PE=3 SV=1 30 300 3.0E-28
sp|Q3K440|ATPG_PSEPF ATP synthase gamma chain OS=Pseudomonas fluorescens (strain Pf0-1) GN=atpG PE=3 SV=1 30 300 3.0E-28
sp|B2JJ96|ATPG_BURP8 ATP synthase gamma chain OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=atpG PE=3 SV=1 30 300 3.0E-28
sp|B5BIN7|ATPG_SALPK ATP synthase gamma chain OS=Salmonella paratyphi A (strain AKU_12601) GN=atpG PE=3 SV=1 33 300 3.0E-28
sp|Q5PKX1|ATPG_SALPA ATP synthase gamma chain OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=atpG PE=3 SV=1 33 300 3.0E-28
sp|Q0VKX3|ATPG_ALCBS ATP synthase gamma chain OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=atpG PE=3 SV=1 30 300 3.0E-28
sp|C3LSJ0|ATPG_VIBCM ATP synthase gamma chain OS=Vibrio cholerae serotype O1 (strain M66-2) GN=atpG PE=3 SV=1 33 300 3.0E-28
sp|Q9KNH4|ATPG_VIBCH ATP synthase gamma chain OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=atpG PE=3 SV=1 33 300 3.0E-28
sp|A5F458|ATPG_VIBC3 ATP synthase gamma chain OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=atpG PE=3 SV=1 33 300 3.0E-28
sp|A9W2R2|ATPG_METEP ATP synthase gamma chain OS=Methylobacterium extorquens (strain PA1) GN=atpG PE=3 SV=1 31 300 4.0E-28
sp|Q3IK49|ATPG_PSEHT ATP synthase gamma chain OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=atpG PE=3 SV=1 30 300 4.0E-28
sp|C4LDW1|ATPG_TOLAT ATP synthase gamma chain OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=atpG PE=3 SV=1 33 300 4.0E-28
sp|B5RFW2|ATPG_SALG2 ATP synthase gamma chain OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=atpG PE=3 SV=1 33 300 4.0E-28
sp|B9DME4|ATPG_STACT ATP synthase gamma chain OS=Staphylococcus carnosus (strain TM300) GN=atpG PE=3 SV=1 30 302 5.0E-28
sp|Q6MGM6|ATPG_BDEBA ATP synthase gamma chain OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=atpG PE=3 SV=1 30 300 5.0E-28
sp|Q2S6P0|ATPG_HAHCH ATP synthase gamma chain OS=Hahella chejuensis (strain KCTC 2396) GN=atpG PE=3 SV=1 30 300 5.0E-28
sp|A9MJR8|ATPG_SALAR ATP synthase gamma chain OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=atpG PE=3 SV=1 33 300 5.0E-28
sp|Q8ZKW8|ATPG_SALTY ATP synthase gamma chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=atpG PE=2 SV=1 33 300 5.0E-28
sp|B4TN32|ATPG_SALSV ATP synthase gamma chain OS=Salmonella schwarzengrund (strain CVM19633) GN=atpG PE=3 SV=1 33 300 5.0E-28
sp|C0Q2N3|ATPG_SALPC ATP synthase gamma chain OS=Salmonella paratyphi C (strain RKS4594) GN=atpG PE=3 SV=1 33 300 5.0E-28
sp|A9MXA7|ATPG_SALPB ATP synthase gamma chain OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=atpG PE=3 SV=1 33 300 5.0E-28
sp|B4SYD2|ATPG_SALNS ATP synthase gamma chain OS=Salmonella newport (strain SL254) GN=atpG PE=3 SV=1 33 300 5.0E-28
sp|B4TAX3|ATPG_SALHS ATP synthase gamma chain OS=Salmonella heidelberg (strain SL476) GN=atpG PE=3 SV=1 33 300 5.0E-28
sp|B5QUS5|ATPG_SALEP ATP synthase gamma chain OS=Salmonella enteritidis PT4 (strain P125109) GN=atpG PE=3 SV=1 33 300 5.0E-28
sp|B5FN34|ATPG_SALDC ATP synthase gamma chain OS=Salmonella dublin (strain CT_02021853) GN=atpG PE=3 SV=1 33 300 5.0E-28
sp|Q57HX8|ATPG_SALCH ATP synthase gamma chain OS=Salmonella choleraesuis (strain SC-B67) GN=atpG PE=3 SV=1 33 300 5.0E-28
sp|B5EYZ7|ATPG_SALA4 ATP synthase gamma chain OS=Salmonella agona (strain SL483) GN=atpG PE=3 SV=1 33 300 5.0E-28
sp|B9JBZ6|ATPG_AGRRK ATP synthase gamma chain OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=atpG PE=3 SV=1 31 300 6.0E-28
sp|B1ZEE8|ATPG_METPB ATP synthase gamma chain OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=atpG PE=3 SV=1 31 300 6.0E-28
sp|Q8PCZ6|ATPG_XANCP ATP synthase gamma chain OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=atpG PE=3 SV=1 33 300 7.0E-28
sp|B0RWC3|ATPG_XANCB ATP synthase gamma chain OS=Xanthomonas campestris pv. campestris (strain B100) GN=atpG PE=3 SV=1 33 300 7.0E-28
sp|Q4UQF3|ATPG_XANC8 ATP synthase gamma chain OS=Xanthomonas campestris pv. campestris (strain 8004) GN=atpG PE=3 SV=1 33 300 7.0E-28
sp|Q8PGG6|ATPG_XANAC ATP synthase gamma chain OS=Xanthomonas axonopodis pv. citri (strain 306) GN=atpG PE=3 SV=1 33 300 7.0E-28
sp|A8ACN7|ATPG_CITK8 ATP synthase gamma chain OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=atpG PE=3 SV=1 33 300 7.0E-28
sp|C4KYS4|ATPG_EXISA ATP synthase gamma chain OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=atpG PE=3 SV=1 30 302 8.0E-28
sp|B8CVU6|ATPG_SHEPW ATP synthase gamma chain OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=atpG PE=3 SV=1 30 300 9.0E-28
sp|A0KQX9|ATPG_AERHH ATP synthase gamma chain OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=atpG PE=3 SV=1 30 300 9.0E-28
sp|Q5H4Y5|ATPG_XANOR ATP synthase gamma chain OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=atpG PE=3 SV=1 33 300 1.0E-27
sp|B2SQB1|ATPG_XANOP ATP synthase gamma chain OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=atpG PE=3 SV=1 33 300 1.0E-27
sp|Q2P7Q5|ATPG_XANOM ATP synthase gamma chain OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=atpG PE=3 SV=1 33 300 1.0E-27
sp|Q7MGH9|ATPG_VIBVY ATP synthase gamma chain OS=Vibrio vulnificus (strain YJ016) GN=atpG PE=3 SV=1 30 300 1.0E-27
sp|Q8DDG9|ATPG_VIBVU ATP synthase gamma chain OS=Vibrio vulnificus (strain CMCP6) GN=atpG PE=3 SV=1 30 300 1.0E-27
sp|P43716|ATPG_HAEIN ATP synthase gamma chain OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atpG PE=3 SV=1 33 300 1.0E-27
sp|Q9HT19|ATPG_PSEAE ATP synthase gamma chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atpG PE=3 SV=1 30 300 1.0E-27
sp|Q02DF3|ATPG_PSEAB ATP synthase gamma chain OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=atpG PE=3 SV=1 30 300 1.0E-27
sp|B7V792|ATPG_PSEA8 ATP synthase gamma chain OS=Pseudomonas aeruginosa (strain LESB58) GN=atpG PE=3 SV=1 30 300 1.0E-27
sp|A6VF33|ATPG_PSEA7 ATP synthase gamma chain OS=Pseudomonas aeruginosa (strain PA7) GN=atpG PE=3 SV=1 30 300 1.0E-27
sp|B1XHY7|ATPG_SYNP2 ATP synthase gamma chain OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=atpG PE=3 SV=1 32 300 1.0E-27
sp|B7K5I9|ATPG_CYAP8 ATP synthase gamma chain OS=Cyanothece sp. (strain PCC 8801) GN=atpG PE=3 SV=1 32 300 1.0E-27
sp|Q3BP14|ATPG_XANC5 ATP synthase gamma chain OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=atpG PE=3 SV=1 33 300 1.0E-27
sp|P33257|ATPG_MYCGA ATP synthase gamma chain OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=atpG PE=3 SV=2 30 298 1.0E-27
sp|Q494C4|ATPG_BLOPB ATP synthase gamma chain OS=Blochmannia pennsylvanicus (strain BPEN) GN=atpG PE=3 SV=1 32 300 1.0E-27
sp|A7ZC36|ATPG_CAMC1 ATP synthase gamma chain OS=Campylobacter concisus (strain 13826) GN=atpG PE=3 SV=1 30 298 1.0E-27
sp|A5UA10|ATPG_HAEIE ATP synthase gamma chain OS=Haemophilus influenzae (strain PittEE) GN=atpG PE=3 SV=1 33 300 1.0E-27
sp|Q8Z2Q5|ATPG_SALTI ATP synthase gamma chain OS=Salmonella typhi GN=atpG PE=3 SV=1 33 300 2.0E-27
sp|A6VL58|ATPG_ACTSZ ATP synthase gamma chain OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=atpG PE=3 SV=1 30 300 2.0E-27
sp|P12990|ATPG_VIBAL ATP synthase gamma chain OS=Vibrio alginolyticus GN=atpG PE=3 SV=1 30 300 2.0E-27
sp|B3PQ69|ATPG_RHIE6 ATP synthase gamma chain OS=Rhizobium etli (strain CIAT 652) GN=atpG PE=3 SV=1 31 300 2.0E-27
sp|A4VS63|ATPG_PSEU5 ATP synthase gamma chain OS=Pseudomonas stutzeri (strain A1501) GN=atpG PE=3 SV=1 30 300 2.0E-27
sp|Q4QN63|ATPG_HAEI8 ATP synthase gamma chain OS=Haemophilus influenzae (strain 86-028NP) GN=atpG PE=3 SV=1 33 300 3.0E-27
sp|Q87KA7|ATPG_VIBPA ATP synthase gamma chain OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=atpG PE=3 SV=1 30 300 3.0E-27
sp|Q6HAX9|ATPG_BACHK ATP synthase gamma chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|Q630U2|ATPG_BACCZ ATP synthase gamma chain OS=Bacillus cereus (strain ZK / E33L) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|Q814W1|ATPG_BACCR ATP synthase gamma chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|B7HY65|ATPG_BACC7 ATP synthase gamma chain OS=Bacillus cereus (strain AH187) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|B7HFK2|ATPG_BACC4 ATP synthase gamma chain OS=Bacillus cereus (strain B4264) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|C1F0M9|ATPG_BACC3 ATP synthase gamma chain OS=Bacillus cereus (strain 03BB102) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|Q72XE7|ATPG_BACC1 ATP synthase gamma chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|B7JGN1|ATPG_BACC0 ATP synthase gamma chain OS=Bacillus cereus (strain AH820) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|Q81JZ4|ATPG_BACAN ATP synthase gamma chain OS=Bacillus anthracis GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|A0RL96|ATPG_BACAH ATP synthase gamma chain OS=Bacillus thuringiensis (strain Al Hakam) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|C3LFI0|ATPG_BACAC ATP synthase gamma chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|C3P1F5|ATPG_BACAA ATP synthase gamma chain OS=Bacillus anthracis (strain A0248) GN=atpG PE=3 SV=1 30 302 3.0E-27
sp|Q6F203|ATPG_MESFL ATP synthase gamma chain OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=atpG PE=3 SV=1 30 300 3.0E-27
sp|A0LDA1|ATPG_MAGMM ATP synthase gamma chain OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=atpG PE=3 SV=1 30 298 3.0E-27
sp|A6UDM2|ATPG_SINMW ATP synthase gamma chain OS=Sinorhizobium medicae (strain WSM419) GN=atpG PE=3 SV=1 31 300 3.0E-27
sp|Q11YP0|ATPG_CYTH3 ATP synthase gamma chain OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=atpG PE=3 SV=1 31 300 4.0E-27
sp|A5FRQ4|ATPG_DEHMB ATP synthase gamma chain OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=atpG PE=3 SV=1 30 300 4.0E-27
sp|B7IQV9|ATPG_BACC2 ATP synthase gamma chain OS=Bacillus cereus (strain G9842) GN=atpG PE=3 SV=1 30 302 4.0E-27
sp|A4Y188|ATPG_PSEMY ATP synthase gamma chain OS=Pseudomonas mendocina (strain ymp) GN=atpG PE=3 SV=1 30 300 4.0E-27
sp|Q477Z2|ATPG_DECAR ATP synthase gamma chain OS=Dechloromonas aromatica (strain RCB) GN=atpG PE=3 SV=1 33 300 4.0E-27
sp|Q6FFK1|ATPG_ACIAD ATP synthase gamma chain OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=atpG PE=3 SV=1 30 300 5.0E-27
sp|Q02BU2|ATPG_SOLUE ATP synthase gamma chain OS=Solibacter usitatus (strain Ellin6076) GN=atpG PE=3 SV=1 35 302 5.0E-27
sp|B1WUI3|ATPG_CYAA5 ATP synthase gamma chain OS=Cyanothece sp. (strain ATCC 51142) GN=atpG PE=3 SV=1 32 300 5.0E-27
sp|A7GV57|ATPG_BACCN ATP synthase gamma chain OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=atpG PE=3 SV=1 30 302 5.0E-27
sp|B4UKF1|ATPG_ANASK ATP synthase gamma chain OS=Anaeromyxobacter sp. (strain K) GN=atpG PE=3 SV=1 31 300 5.0E-27
sp|A6T471|ATPG_JANMA ATP synthase gamma chain OS=Janthinobacterium sp. (strain Marseille) GN=atpG PE=3 SV=1 30 300 6.0E-27
sp|P29790|ATPG_TOBAC ATP synthase gamma chain, chloroplastic OS=Nicotiana tabacum GN=ATPC PE=1 SV=1 29 300 7.0E-27
sp|A0RR27|ATPG_CAMFF ATP synthase gamma chain OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=atpG PE=3 SV=1 30 298 7.0E-27
sp|Q87E89|ATPG_XYLFT ATP synthase gamma chain OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=atpG PE=3 SV=1 30 300 8.0E-27
sp|B2I861|ATPG_XYLF2 ATP synthase gamma chain OS=Xylella fastidiosa (strain M23) GN=atpG PE=3 SV=1 30 300 8.0E-27
sp|P41169|ATPG_ACIFR ATP synthase gamma chain OS=Acidithiobacillus ferrooxidans GN=atpG PE=3 SV=1 30 303 9.0E-27
sp|B1YMR5|ATPG_EXIS2 ATP synthase gamma chain OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=atpG PE=3 SV=1 30 302 1.0E-26
sp|A7NIR0|ATPG_ROSCS ATP synthase gamma chain OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=atpG PE=3 SV=1 33 304 1.0E-26
sp|B1HM55|ATPG_LYSSC ATP synthase gamma chain OS=Lysinibacillus sphaericus (strain C3-41) GN=atpG PE=3 SV=1 32 302 1.0E-26
sp|B8JCV1|ATPG_ANAD2 ATP synthase gamma chain OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=atpG PE=3 SV=1 31 300 1.0E-26
sp|Q2JIG1|ATPG_SYNJB ATP synthase gamma chain OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=atpG PE=3 SV=1 30 300 1.0E-26
sp|A5UQN4|ATPG_ROSS1 ATP synthase gamma chain OS=Roseiflexus sp. (strain RS-1) GN=atpG PE=3 SV=1 33 304 1.0E-26
sp|B0BZL3|ATPG_ACAM1 ATP synthase gamma chain OS=Acaryochloris marina (strain MBIC 11017) GN=atpG PE=3 SV=1 32 300 1.0E-26
sp|B0VBP4|ATPG_ACIBY ATP synthase gamma chain OS=Acinetobacter baumannii (strain AYE) GN=atpG PE=3 SV=1 30 300 1.0E-26
sp|A3M143|ATPG_ACIBT ATP synthase gamma chain OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=atpG PE=3 SV=2 30 300 1.0E-26
sp|B0VNK3|ATPG_ACIBS ATP synthase gamma chain OS=Acinetobacter baumannii (strain SDF) GN=atpG PE=3 SV=1 30 300 1.0E-26
sp|B2I101|ATPG_ACIBC ATP synthase gamma chain OS=Acinetobacter baumannii (strain ACICU) GN=atpG PE=3 SV=1 30 300 1.0E-26
sp|B7H295|ATPG_ACIB3 ATP synthase gamma chain OS=Acinetobacter baumannii (strain AB307-0294) GN=atpG PE=3 SV=1 30 300 1.0E-26
sp|Q8UC75|ATPG_AGRFC ATP synthase gamma chain OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=atpG PE=3 SV=1 31 300 1.0E-26
sp|A8EV71|ATPG_ARCB4 ATP synthase gamma chain OS=Arcobacter butzleri (strain RM4018) GN=atpG PE=3 SV=1 30 300 1.0E-26
sp|C1D5G3|ATPG_LARHH ATP synthase gamma chain OS=Laribacter hongkongensis (strain HLHK9) GN=atpG PE=3 SV=1 33 300 1.0E-26
sp|B0T336|ATPG_CAUSK ATP synthase gamma chain OS=Caulobacter sp. (strain K31) GN=atpG PE=3 SV=1 30 300 2.0E-26
sp|Q13SQ1|ATPG_BURXL ATP synthase gamma chain OS=Burkholderia xenovorans (strain LB400) GN=atpG PE=3 SV=1 30 300 2.0E-26
sp|A1UR48|ATPG_BARBK ATP synthase gamma chain OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=atpG PE=3 SV=1 30 300 2.0E-26
sp|Q12GQ1|ATPG_POLSJ ATP synthase gamma chain OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=atpG PE=3 SV=1 33 300 2.0E-26
sp|Q39KX7|ATPG_BURL3 ATP synthase gamma chain OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=atpG PE=3 SV=1 30 300 2.0E-26
sp|Q7VA64|ATPG_PROMA ATP synthase gamma chain OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=atpG PE=3 SV=1 30 299 2.0E-26
sp|B2T7K1|ATPG_BURPP ATP synthase gamma chain OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=atpG PE=3 SV=1 30 300 2.0E-26
sp|A5CVI7|ATPG_VESOH ATP synthase gamma chain OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=atpG PE=3 SV=1 33 298 2.0E-26
sp|B9JTR3|ATPG_AGRVS ATP synthase gamma chain OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=atpG PE=3 SV=1 31 300 3.0E-26
sp|B8I578|ATPG_CLOCE ATP synthase gamma chain OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=atpG PE=3 SV=1 32 302 3.0E-26
sp|Q3Z8Z3|ATPG_DEHM1 ATP synthase gamma chain OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=atpG PE=3 SV=1 41 300 3.0E-26
sp|A9AVV3|ATPG_HERA2 ATP synthase gamma chain OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=atpG PE=3 SV=1 30 300 3.0E-26
sp|B0U599|ATPG_XYLFM ATP synthase gamma chain OS=Xylella fastidiosa (strain M12) GN=atpG PE=3 SV=1 30 300 3.0E-26
sp|Q2LQZ6|ATPG_SYNAS ATP synthase gamma chain OS=Syntrophus aciditrophicus (strain SB) GN=atpG PE=3 SV=1 30 300 4.0E-26
sp|Q6G1W8|ATPG_BARHE ATP synthase gamma chain OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=atpG PE=3 SV=1 30 300 4.0E-26
sp|A9VSA4|ATPG_BACWK ATP synthase gamma chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=atpG PE=3 SV=1 30 302 4.0E-26
sp|A4YKD9|ATPG_BRASO ATP synthase gamma chain OS=Bradyrhizobium sp. (strain ORS278) GN=atpG PE=3 SV=1 30 300 4.0E-26
sp|Q0BJL6|ATPG_BURCM ATP synthase gamma chain OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=atpG PE=3 SV=1 30 300 4.0E-26
sp|B1YQL3|ATPG_BURA4 ATP synthase gamma chain OS=Burkholderia ambifaria (strain MC40-6) GN=atpG PE=3 SV=1 30 300 4.0E-26
sp|B7KKR3|ATPG_CYAP7 ATP synthase gamma chain OS=Cyanothece sp. (strain PCC 7424) GN=atpG PE=3 SV=1 32 300 4.0E-26
sp|Q1MAZ1|ATPG_RHIL3 ATP synthase gamma chain OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=atpG PE=3 SV=1 31 300 4.0E-26
sp|A7H018|ATPG_CAMC5 ATP synthase gamma chain OS=Campylobacter curvus (strain 525.92) GN=atpG PE=3 SV=1 30 298 5.0E-26
sp|A9KK93|ATPG_CLOPH ATP synthase gamma chain OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=atpG PE=3 SV=1 30 300 5.0E-26
sp|A1TJ40|ATPG_ACIAC ATP synthase gamma chain OS=Acidovorax citrulli (strain AAC00-1) GN=atpG PE=3 SV=1 33 300 5.0E-26
sp|Q60CR5|ATPG_METCA ATP synthase gamma chain OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=atpG PE=3 SV=1 30 300 5.0E-26
sp|Q7VU45|ATPG_BORPE ATP synthase gamma chain OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=atpG PE=3 SV=1 32 300 5.0E-26
sp|C1A697|ATPG_GEMAT ATP synthase gamma chain OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=atpG PE=3 SV=1 33 300 6.0E-26
sp|Q7WEM8|ATPG_BORBR ATP synthase gamma chain OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=atpG PE=3 SV=1 32 300 6.0E-26
sp|Q9PE84|ATPG_XYLFA ATP synthase gamma chain OS=Xylella fastidiosa (strain 9a5c) GN=atpG PE=3 SV=1 30 300 6.0E-26
sp|Q21DK7|ATPG_SACD2 ATP synthase gamma chain OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=atpG PE=3 SV=1 30 300 6.0E-26
sp|Q2JSW2|ATPG_SYNJA ATP synthase gamma chain OS=Synechococcus sp. (strain JA-3-3Ab) GN=atpG PE=3 SV=1 30 300 7.0E-26
sp|C4K904|ATPG_HAMD5 ATP synthase gamma chain OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=atpG PE=3 SV=1 33 300 7.0E-26
sp|B5ZSN8|ATPG_RHILW ATP synthase gamma chain OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=atpG PE=3 SV=1 31 300 7.0E-26
sp|A9AJG3|ATPG_BURM1 ATP synthase gamma chain OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=atpG PE=3 SV=1 30 300 8.0E-26
sp|Q7W3A9|ATPG_BORPA ATP synthase gamma chain OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=atpG PE=3 SV=1 32 300 9.0E-26
sp|A2SC69|ATPG_METPP ATP synthase gamma chain OS=Methylibium petroleiphilum (strain PM1) GN=atpG PE=3 SV=1 33 300 9.0E-26
sp|Q2ST35|ATPG_MYCCT ATP synthase gamma chain OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=atpG PE=3 SV=1 41 298 9.0E-26
sp|A5N3H8|ATPG_CLOK5 ATP synthase gamma chain OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=atpG PE=3 SV=1 26 300 9.0E-26
sp|B9DX62|ATPG_CLOK1 ATP synthase gamma chain OS=Clostridium kluyveri (strain NBRC 12016) GN=atpG PE=3 SV=1 26 300 9.0E-26
sp|Q06908|ATPG_ODOSI ATP synthase gamma chain, chloroplastic OS=Odontella sinensis GN=ATPC PE=1 SV=1 35 302 1.0E-25
sp|B4EEY8|ATPG_BURCJ ATP synthase gamma chain OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=atpG PE=3 SV=1 30 300 1.0E-25
sp|Q0AKV9|ATPG_MARMM ATP synthase gamma chain OS=Maricaulis maris (strain MCS10) GN=atpG PE=3 SV=1 30 300 1.0E-25
sp|A5FL19|ATPG_FLAJ1 ATP synthase gamma chain OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=atpG PE=3 SV=1 30 300 1.0E-25
sp|Q2NQ87|ATPG_SODGM ATP synthase gamma chain OS=Sodalis glossinidius (strain morsitans) GN=atpG PE=3 SV=1 33 300 1.0E-25
sp|A8ZUA0|ATPG_DESOH ATP synthase gamma chain OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=atpG PE=3 SV=1 31 300 1.0E-25
sp|P17253|ATPG_SYNY3 ATP synthase gamma chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=atpG PE=3 SV=1 32 300 1.0E-25
sp|A5E949|ATPG_BRASB ATP synthase gamma chain OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=atpG PE=3 SV=1 30 300 1.0E-25
sp|A4GAH0|ATPG_HERAR ATP synthase gamma chain OS=Herminiimonas arsenicoxydans GN=atpG PE=3 SV=1 30 300 1.0E-25
sp|Q6KI81|ATPG_MYCMO ATP synthase gamma chain OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=atpG PE=3 SV=1 30 298 2.0E-25
sp|A9IYW8|ATPG_BART1 ATP synthase gamma chain OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=atpG PE=3 SV=1 30 300 2.0E-25
sp|B3EU99|ATPG_AMOA5 ATP synthase gamma chain OS=Amoebophilus asiaticus (strain 5a2) GN=atpG PE=3 SV=1 32 300 2.0E-25
sp|Q5QZI5|ATPG_IDILO ATP synthase gamma chain OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=atpG PE=3 SV=1 30 300 2.0E-25
sp|Q6MS93|ATPG_MYCMS ATP synthase gamma chain OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=atpG PE=3 SV=1 41 300 2.0E-25
sp|Q7NDC0|ATPG_GLOVI ATP synthase gamma chain OS=Gloeobacter violaceus (strain PCC 7421) GN=atpG PE=3 SV=1 32 300 2.0E-25
sp|Q0I7R3|ATPG_SYNS3 ATP synthase gamma chain OS=Synechococcus sp. (strain CC9311) GN=atpG PE=3 SV=1 30 301 2.0E-25
sp|Q8RGE1|ATPG_FUSNN ATP synthase gamma chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=atpG PE=3 SV=1 32 300 2.0E-25
sp|Q4L7Y5|ATPG_STAHJ ATP synthase gamma chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpG PE=3 SV=1 30 302 2.0E-25
sp|Q6FYM2|ATPG_BARQU ATP synthase gamma chain OS=Bartonella quintana (strain Toulouse) GN=atpG PE=3 SV=1 30 300 3.0E-25
sp|A0Q2Z5|ATPG_CLONN ATP synthase gamma chain OS=Clostridium novyi (strain NT) GN=atpG PE=3 SV=1 30 302 3.0E-25
sp|B1Y3S8|ATPG_LEPCP ATP synthase gamma chain OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=atpG PE=3 SV=1 33 300 3.0E-25
sp|Q46J58|ATPG_PROMT ATP synthase gamma chain OS=Prochlorococcus marinus (strain NATL2A) GN=atpG PE=3 SV=1 30 300 3.0E-25
sp|B2UGV0|ATPG_RALPJ ATP synthase gamma chain OS=Ralstonia pickettii (strain 12J) GN=atpG PE=3 SV=1 33 300 3.0E-25
sp|Q1LHK9|ATPG_CUPMC ATP synthase gamma chain OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=atpG PE=3 SV=1 30 300 3.0E-25
sp|Q73FU0|ATPG_WOLPM ATP synthase gamma chain OS=Wolbachia pipientis wMel GN=atpG PE=3 SV=1 31 298 3.0E-25
sp|Q2S431|ATPG_SALRD ATP synthase gamma chain OS=Salinibacter ruber (strain DSM 13855 / M31) GN=atpG PE=3 SV=1 30 303 3.0E-25
sp|P0C1M0|ATPG_MAIZE ATP synthase subunit gamma, chloroplastic OS=Zea mays PE=1 SV=1 19 300 4.0E-25
sp|A1WZT2|ATPG_HALHL ATP synthase gamma chain OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=atpG PE=3 SV=1 30 300 4.0E-25
sp|B3CMR1|ATPG_WOLPP ATP synthase gamma chain OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=atpG PE=3 SV=1 31 298 4.0E-25
sp|Q7P096|ATPG_CHRVO ATP synthase gamma chain OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=atpG PE=3 SV=2 33 300 4.0E-25
sp|A2C4J4|ATPG_PROM1 ATP synthase gamma chain OS=Prochlorococcus marinus (strain NATL1A) GN=atpG PE=3 SV=1 30 300 4.0E-25
sp|Q49Z51|ATPG_STAS1 ATP synthase gamma chain OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=atpG PE=3 SV=1 30 302 5.0E-25
sp|B3QWX8|ATPG_CHLT3 ATP synthase gamma chain OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=atpG PE=3 SV=1 30 302 6.0E-25
sp|A0M6G3|ATPG_GRAFK ATP synthase gamma chain OS=Gramella forsetii (strain KT0803) GN=atpG PE=3 SV=1 30 300 7.0E-25
sp|A6WXX0|ATPG_OCHA4 ATP synthase gamma chain OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=atpG PE=3 SV=1 31 300 7.0E-25
sp|B9L7Y6|ATPG_NAUPA ATP synthase gamma chain OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=atpG PE=3 SV=1 30 300 7.0E-25
sp|C1DND4|ATPG_AZOVD ATP synthase gamma chain OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=atpG PE=3 SV=1 30 300 8.0E-25
sp|A8FIB3|ATPG_BACP2 ATP synthase gamma chain OS=Bacillus pumilus (strain SAFR-032) GN=atpG PE=3 SV=1 30 302 8.0E-25
sp|C3M9S2|ATPG_RHISN ATP synthase gamma chain OS=Rhizobium sp. (strain NGR234) GN=atpG PE=3 SV=1 31 300 8.0E-25
sp|B4RS82|ATPG_ALTMD ATP synthase gamma chain OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=atpG PE=3 SV=1 30 300 8.0E-25
sp|Q8EWY9|ATPG_MYCPE ATP synthase gamma chain OS=Mycoplasma penetrans (strain HF-2) GN=atpG PE=3 SV=1 30 298 9.0E-25
sp|A1U7H5|ATPG_MARHV ATP synthase gamma chain OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=atpG PE=3 SV=1 30 300 9.0E-25
sp|Q41075|ATPG_PHATR ATP synthase gamma chain, chloroplastic OS=Phaeodactylum tricornutum GN=ATPC PE=2 SV=1 35 300 1.0E-24
sp|P12113|ATPG_CHLRE ATP synthase gamma chain, chloroplastic OS=Chlamydomonas reinhardtii GN=ATPC PE=1 SV=1 30 301 1.0E-24
sp|A9HY41|ATPG_BORPD ATP synthase gamma chain OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=atpG PE=3 SV=1 32 300 1.0E-24
sp|B2V6N5|ATPG_SULSY ATP synthase gamma chain OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=atpG PE=3 SV=1 33 300 1.0E-24
sp|Q5GRT1|ATPG_WOLTR ATP synthase gamma chain OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=atpG PE=3 SV=1 31 298 1.0E-24
sp|P09222|ATPG_BACP3 ATP synthase gamma chain OS=Bacillus sp. (strain PS3) GN=atpG PE=1 SV=1 30 300 1.0E-24
sp|A5GV71|ATPG_SYNR3 ATP synthase gamma chain OS=Synechococcus sp. (strain RCC307) GN=atpG PE=3 SV=1 30 300 1.0E-24
sp|B3H2P4|ATPG_ACTP7 ATP synthase gamma chain OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=atpG PE=3 SV=1 33 300 1.0E-24
sp|A3N2U5|ATPG_ACTP2 ATP synthase gamma chain OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=atpG PE=3 SV=1 33 300 1.0E-24
sp|B8G6G7|ATPG_CHLAD ATP synthase gamma chain OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=atpG PE=3 SV=1 30 300 1.0E-24
sp|A7Z9Q1|ATPG_BACMF ATP synthase gamma chain OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=atpG PE=3 SV=1 30 302 1.0E-24
sp|B3R7L6|ATPG_CUPTR ATP synthase gamma chain OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=atpG PE=3 SV=1 30 300 1.0E-24
sp|A6TK64|ATPG_ALKMQ ATP synthase gamma chain OS=Alkaliphilus metalliredigens (strain QYMF) GN=atpG PE=3 SV=1 32 300 1.0E-24
sp|A9M838|ATPG_BRUC2 ATP synthase gamma chain OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=atpG PE=3 SV=1 31 300 1.0E-24
sp|B0UWG6|ATPG_HISS2 ATP synthase gamma chain OS=Histophilus somni (strain 2336) GN=atpG PE=3 SV=1 33 300 2.0E-24
sp|C5BKJ6|ATPG_TERTT ATP synthase gamma chain OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=atpG PE=3 SV=1 30 300 2.0E-24
sp|Q8FYR4|ATPG_BRUSU ATP synthase gamma chain OS=Brucella suis biovar 1 (strain 1330) GN=atpG PE=3 SV=1 31 300 2.0E-24
sp|A9WWS3|ATPG_BRUSI ATP synthase gamma chain OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=atpG PE=3 SV=1 31 300 2.0E-24
sp|A5VSE2|ATPG_BRUO2 ATP synthase gamma chain OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=atpG PE=3 SV=1 31 300 2.0E-24
sp|A1T0Z0|ATPG_PSYIN ATP synthase gamma chain OS=Psychromonas ingrahamii (strain 37) GN=atpG PE=3 SV=1 33 300 2.0E-24
sp|A1VIV1|ATPG_POLNA ATP synthase gamma chain OS=Polaromonas naphthalenivorans (strain CJ2) GN=atpG PE=3 SV=1 33 300 2.0E-24
sp|Q98EV7|ATPG_RHILO ATP synthase gamma chain OS=Rhizobium loti (strain MAFF303099) GN=atpG PE=3 SV=1 31 300 2.0E-24
sp|B4U6A3|ATPG_HYDS0 ATP synthase gamma chain OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=atpG PE=3 SV=1 33 302 2.0E-24
sp|B9LBM1|ATPG_CHLSY ATP synthase gamma chain OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=atpG PE=3 SV=1 33 300 2.0E-24
sp|A9WGS5|ATPG_CHLAA ATP synthase gamma chain OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=atpG PE=3 SV=1 33 300 2.0E-24
sp|Q89B40|ATPG_BUCBP ATP synthase gamma chain OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=atpG PE=3 SV=1 32 300 2.0E-24
sp|Q2STE8|ATPG_BURTA ATP synthase gamma chain OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=atpG PE=3 SV=1 30 300 3.0E-24
sp|B5Z8D1|ATPG_HELPG ATP synthase gamma chain OS=Helicobacter pylori (strain G27) GN=atpG PE=3 SV=1 30 300 3.0E-24
sp|B0BRX3|ATPG_ACTPJ ATP synthase gamma chain OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=atpG PE=3 SV=1 33 300 3.0E-24
sp|Q0I5X2|ATPG_HAES1 ATP synthase gamma chain OS=Haemophilus somnus (strain 129Pt) GN=atpG PE=3 SV=1 33 300 3.0E-24
sp|Q0K5M6|ATPG_CUPNH ATP synthase gamma chain OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=atpG PE=3 SV=1 30 300 3.0E-24
sp|Q2KU35|ATPG_BORA1 ATP synthase gamma chain OS=Bordetella avium (strain 197N) GN=atpG PE=3 SV=1 32 300 4.0E-24
sp|Q92LK7|ATPG_RHIME ATP synthase gamma chain OS=Rhizobium meliloti (strain 1021) GN=atpG PE=3 SV=1 31 300 4.0E-24
sp|Q1GXM9|ATPG_METFK ATP synthase gamma chain OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=atpG PE=3 SV=1 33 300 4.0E-24
sp|Q3YS74|ATPG_EHRCJ ATP synthase gamma chain OS=Ehrlichia canis (strain Jake) GN=atpG PE=3 SV=1 30 297 5.0E-24
sp|Q1CSD4|ATPG_HELPH ATP synthase gamma chain OS=Helicobacter pylori (strain HPAG1) GN=atpG PE=3 SV=1 30 300 5.0E-24
sp|A3PET8|ATPG_PROM0 ATP synthase gamma chain OS=Prochlorococcus marinus (strain MIT 9301) GN=atpG PE=3 SV=1 30 300 5.0E-24
sp|A2BT24|ATPG_PROMS ATP synthase gamma chain OS=Prochlorococcus marinus (strain AS9601) GN=atpG PE=3 SV=1 30 298 5.0E-24
sp|A9BCD8|ATPG_PROM4 ATP synthase gamma chain OS=Prochlorococcus marinus (strain MIT 9211) GN=atpG PE=3 SV=1 30 300 5.0E-24
sp|Q2GGH2|ATPG_EHRCR ATP synthase gamma chain OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=atpG PE=3 SV=1 30 297 5.0E-24
sp|A6LQH5|ATPG_CLOB8 ATP synthase gamma chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=atpG PE=3 SV=1 28 300 6.0E-24
sp|C5D991|ATPG_GEOSW ATP synthase gamma chain OS=Geobacillus sp. (strain WCH70) GN=atpG PE=3 SV=1 30 300 6.0E-24
sp|B2UUP1|ATPG_HELPS ATP synthase gamma chain OS=Helicobacter pylori (strain Shi470) GN=atpG PE=3 SV=1 30 300 6.0E-24
sp|Q7V5S8|ATPG_PROMM ATP synthase gamma chain OS=Prochlorococcus marinus (strain MIT 9313) GN=atpG PE=3 SV=1 30 298 6.0E-24
sp|A2BYH5|ATPG_PROM5 ATP synthase gamma chain OS=Prochlorococcus marinus (strain MIT 9515) GN=atpG PE=3 SV=1 30 298 7.0E-24
sp|Q63PH9|ATPG_BURPS ATP synthase gamma chain OS=Burkholderia pseudomallei (strain K96243) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|A3NF41|ATPG_BURP6 ATP synthase gamma chain OS=Burkholderia pseudomallei (strain 668) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|Q3JXV7|ATPG_BURP1 ATP synthase gamma chain OS=Burkholderia pseudomallei (strain 1710b) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|A1V8T2|ATPG_BURMS ATP synthase gamma chain OS=Burkholderia mallei (strain SAVP1) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|Q62FR6|ATPG_BURMA ATP synthase gamma chain OS=Burkholderia mallei (strain ATCC 23344) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|A2S6J9|ATPG_BURM9 ATP synthase gamma chain OS=Burkholderia mallei (strain NCTC 10229) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|A3MQJ8|ATPG_BURM7 ATP synthase gamma chain OS=Burkholderia mallei (strain NCTC 10247) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|A3P0Z1|ATPG_BURP0 ATP synthase gamma chain OS=Burkholderia pseudomallei (strain 1106a) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|Q9ZK80|ATPG_HELPJ ATP synthase gamma chain OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|A2C6X6|ATPG_PROM3 ATP synthase gamma chain OS=Prochlorococcus marinus (strain MIT 9303) GN=atpG PE=3 SV=1 30 298 7.0E-24
sp|B6JMX3|ATPG_HELP2 ATP synthase gamma chain OS=Helicobacter pylori (strain P12) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|A8G6V0|ATPG_PROM2 ATP synthase gamma chain OS=Prochlorococcus marinus (strain MIT 9215) GN=atpG PE=3 SV=1 30 300 7.0E-24
sp|Q5KUJ2|ATPG_GEOKA ATP synthase gamma chain OS=Geobacillus kaustophilus (strain HTA426) GN=atpG PE=1 SV=1 30 300 8.0E-24
sp|P37810|ATPG_BACSU ATP synthase gamma chain OS=Bacillus subtilis (strain 168) GN=atpG PE=1 SV=2 30 302 8.0E-24
sp|Q65DX3|ATPG_BACLD ATP synthase gamma chain OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=atpG PE=3 SV=1 30 302 1.0E-23
sp|B0JWV2|ATPG_MICAN ATP synthase gamma chain OS=Microcystis aeruginosa (strain NIES-843) GN=atpG PE=3 SV=1 32 300 1.0E-23
sp|A5GNC7|ATPG_SYNPW ATP synthase gamma chain OS=Synechococcus sp. (strain WH7803) GN=atpG PE=3 SV=1 30 300 1.0E-23
sp|P56082|ATPG_HELPY ATP synthase gamma chain OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=atpG PE=3 SV=1 30 300 1.0E-23
sp|Q8XU75|ATPG_RALSO ATP synthase gamma chain OS=Ralstonia solanacearum (strain GMI1000) GN=atpG PE=3 SV=1 30 300 1.0E-23
sp|Q3AHK6|ATPG_SYNSC ATP synthase gamma chain OS=Synechococcus sp. (strain CC9605) GN=atpG PE=3 SV=1 30 300 1.0E-23
sp|Q7VPP1|ATPG_HAEDU ATP synthase gamma chain OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=atpG PE=3 SV=1 33 300 2.0E-23
sp|Q7A0C5|ATPG_STAAW ATP synthase gamma chain OS=Staphylococcus aureus (strain MW2) GN=atpG PE=3 SV=1 30 302 2.0E-23
sp|A8YY71|ATPG_STAAT ATP synthase gamma chain OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=atpG PE=3 SV=1 30 302 2.0E-23
sp|Q6G7K6|ATPG_STAAS ATP synthase gamma chain OS=Staphylococcus aureus (strain MSSA476) GN=atpG PE=3 SV=1 30 302 2.0E-23
sp|Q6GEX1|ATPG_STAAR ATP synthase gamma chain OS=Staphylococcus aureus (strain MRSA252) GN=atpG PE=3 SV=1 30 302 2.0E-23
sp|Q7A4E8|ATPG_STAAN ATP synthase gamma chain OS=Staphylococcus aureus (strain N315) GN=atpG PE=1 SV=1 30 302 2.0E-23
sp|Q99SF4|ATPG_STAAM ATP synthase gamma chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=atpG PE=3 SV=1 30 302 2.0E-23
sp|A6QIU8|ATPG_STAAE ATP synthase gamma chain OS=Staphylococcus aureus (strain Newman) GN=atpG PE=3 SV=1 30 302 2.0E-23
sp|Q5HE96|ATPG_STAAC ATP synthase gamma chain OS=Staphylococcus aureus (strain COL) GN=atpG PE=3 SV=1 30 302 2.0E-23
sp|A5IUP9|ATPG_STAA9 ATP synthase gamma chain OS=Staphylococcus aureus (strain JH9) GN=atpG PE=3 SV=1 30 302 2.0E-23
sp|A6U3I9|ATPG_STAA2 ATP synthase gamma chain OS=Staphylococcus aureus (strain JH1) GN=atpG PE=3 SV=1 30 302 2.0E-23
sp|A7X4U4|ATPG_STAA1 ATP synthase gamma chain OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=atpG PE=3 SV=1 30 302 2.0E-23
sp|Q0C0Z9|ATPG_HYPNA ATP synthase gamma chain OS=Hyphomonas neptunium (strain ATCC 15444) GN=atpG PE=3 SV=1 31 300 2.0E-23
sp|C0R4Q0|ATPG_WOLWR ATP synthase gamma chain OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=atpG PE=3 SV=1 31 298 2.0E-23
sp|Q67TB8|ATPG_SYMTH ATP synthase gamma chain OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=atpG PE=3 SV=1 35 300 2.0E-23
sp|Q2YUK0|ATPG_STAAB ATP synthase gamma chain OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=atpG PE=3 SV=1 30 302 3.0E-23
sp|Q7V038|ATPG_PROMP ATP synthase gamma chain OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=atpG PE=3 SV=1 30 298 3.0E-23
sp|Q318U2|ATPG_PROM9 ATP synthase gamma chain OS=Prochlorococcus marinus (strain MIT 9312) GN=atpG PE=3 SV=1 30 298 3.0E-23
sp|Q8YJ36|ATPG_BRUME ATP synthase gamma chain OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=atpG PE=3 SV=1 31 300 4.0E-23
sp|C0RF51|ATPG_BRUMB ATP synthase gamma chain OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=atpG PE=3 SV=1 31 300 4.0E-23
sp|Q57B87|ATPG_BRUAB ATP synthase gamma chain OS=Brucella abortus biovar 1 (strain 9-941) GN=atpG PE=3 SV=1 31 300 4.0E-23
sp|Q2YLI6|ATPG_BRUA2 ATP synthase gamma chain OS=Brucella abortus (strain 2308) GN=atpG PE=3 SV=1 31 300 4.0E-23
sp|B2S7M4|ATPG_BRUA1 ATP synthase gamma chain OS=Brucella abortus (strain S19) GN=atpG PE=3 SV=1 31 300 4.0E-23
sp|A4SGM8|ATPG_CHLPM ATP synthase gamma chain OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=atpG PE=3 SV=1 31 303 4.0E-23
sp|Q98QU4|ATPG_MYCPU ATP synthase gamma chain OS=Mycoplasma pulmonis (strain UAB CTIP) GN=atpG PE=3 SV=1 31 299 4.0E-23
sp|Q46VX9|ATPG_CUPPJ ATP synthase gamma chain OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=atpG PE=3 SV=1 30 300 4.0E-23
sp|Q8CNJ6|ATPG_STAES ATP synthase gamma chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=atpG PE=3 SV=1 30 302 5.0E-23
sp|Q5HMB8|ATPG_STAEQ ATP synthase gamma chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=atpG PE=3 SV=1 30 302 5.0E-23
sp|P41010|ATPG_BACCA ATP synthase gamma chain OS=Bacillus caldotenax GN=atpG PE=3 SV=1 30 300 5.0E-23
sp|C5CNB2|ATPG_VARPS ATP synthase gamma chain OS=Variovorax paradoxus (strain S110) GN=atpG PE=3 SV=1 33 296 6.0E-23
sp|Q5P4E3|ATPG_AROAE ATP synthase gamma chain OS=Aromatoleum aromaticum (strain EbN1) GN=atpG PE=3 SV=1 30 300 6.0E-23
sp|Q1GQS6|ATPG_SPHAL ATP synthase gamma chain OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=atpG PE=3 SV=1 30 300 7.0E-23
sp|A6L4M5|ATPG_BACV8 ATP synthase gamma chain OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=atpG PE=3 SV=1 30 300 7.0E-23
sp|Q17Y79|ATPG_HELAH ATP synthase gamma chain OS=Helicobacter acinonychis (strain Sheeba) GN=atpG PE=3 SV=1 30 300 8.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1) Yes
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism Yes
GO:0015986 proton motive force-driven ATP synthesis Yes
GO:0006807 nitrogen compound metabolic process No
GO:0006754 ATP biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0015252 proton channel activity No
GO:0009259 ribonucleotide metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0015075 ion transmembrane transporter activity No
GO:0044237 cellular metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0009145 purine nucleoside triphosphate biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0009260 ribonucleotide biosynthetic process No
GO:0005575 cellular_component No
GO:0008324 cation transmembrane transporter activity No
GO:0009117 nucleotide metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0009206 purine ribonucleoside triphosphate biosynthetic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0008150 biological_process No
GO:0090407 organophosphate biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0003674 molecular_function No
GO:0006793 phosphorus metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0005216 ion channel activity No
GO:0009987 cellular process No
GO:0016874 ligase activity No
GO:0033178 proton-transporting two-sector ATPase complex, catalytic domain No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0009058 biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0098796 membrane protein complex No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0009201 ribonucleoside triphosphate biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0022857 transmembrane transporter activity No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0022803 passive transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0071704 organic substance metabolic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0046034 ATP metabolic process No
GO:0015267 channel activity No
GO:0006163 purine nucleotide metabolic process No
GO:0009142 nucleoside triphosphate biosynthetic process No
GO:0005215 transporter activity No
GO:0005261 cation channel activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6345
MLSRTARPALRAATATLAAPPWTATAAGYATLREIDARRKSIRNIEKITKTMKIVASTKLNRAQRSMVESRKYGQ
TSNEVFEAAETKPTEAAEGAAKTLIIVCSSDKGLCGGIHSGMSRKIRSMSLEKNQPTFDLAIIGEKCKAQLHRTN
GNQIQLTFAGVGKDVPTFADAQAMADQIMMLPTEYTDVKILYNKFINAQSYEPTFIEAFSEEAIAQSPNISAFEV
DDEVLANLREYSLANSLYWALAEGHACEQSARRNAMDNASKNAGKMINKYQILYNRTRQAVITGELVEIITGATA
SEDM*
Coding >OphauB2|6345
ATGCTGTCTCGCACGGCTAGACCAGCTCTACGAGCTGCCACGGCCACACTGGCGGCCCCCCCATGGACTGCCACG
GCTGCCGGCTATGCCACGCTTCGCGAAATCGACGCTCGCCGCAAGTCGATTCGCAACATTGAGAAAATCACAAAA
ACCATGAAGATTGTTGCTTCAACCAAGCTCAACCGCGCTCAGCGCTCCATGGTGGAATCGCGCAAGTACGGCCAG
ACGTCCAACGAGGTTTTCGAAGCAGCCGAGACCAAACCTACCGAGGCGGCTGAAGGCGCCGCCAAGACGCTCATC
ATTGTCTGCTCCTCGGACAAGGGCCTCTGCGGCGGCATCCACTCGGGCATGAGTCGCAAGATCCGCTCCATGTCC
CTCGAGAAGAATCAGCCCACCTTTGATCTCGCCATTATTGGCGAAAAGTGCAAGGCGCAGCTGCATCGCACAAAC
GGAAACCAAATCCAGCTGACCTTTGCCGGCGTGGGCAAGGACGTGCCCACCTTTGCCGACGCCCAGGCCATGGCC
GACCAAATCATGATGCTGCCTACCGAATACACAGACGTCAAGATTCTCTACAACAAGTTTATCAATGCCCAGAGC
TACGAGCCCACCTTTATCGAGGCTTTTTCCGAGGAGGCTATTGCCCAATCGCCAAACATCTCGGCTTTCGAGGTG
GACGATGAGGTTCTCGCCAATCTGCGCGAGTACAGCCTCGCCAACTCGCTCTACTGGGCTCTTGCCGAAGGCCAC
GCCTGCGAACAGTCTGCCCGAAGAAATGCCATGGACAATGCCTCCAAGAACGCCGGCAAGATGATCAACAAGTAC
CAGATTCTGTATAATCGCACCCGACAGGCCGTCATTACTGGAGAGTTGGTTGAAATCATCACTGGTGCTACCGCC
TCCGAGGACATGTAG
Transcript >OphauB2|6345
ATGCTGTCTCGCACGGCTAGACCAGCTCTACGAGCTGCCACGGCCACACTGGCGGCCCCCCCATGGACTGCCACG
GCTGCCGGCTATGCCACGCTTCGCGAAATCGACGCTCGCCGCAAGTCGATTCGCAACATTGAGAAAATCACAAAA
ACCATGAAGATTGTTGCTTCAACCAAGCTCAACCGCGCTCAGCGCTCCATGGTGGAATCGCGCAAGTACGGCCAG
ACGTCCAACGAGGTTTTCGAAGCAGCCGAGACCAAACCTACCGAGGCGGCTGAAGGCGCCGCCAAGACGCTCATC
ATTGTCTGCTCCTCGGACAAGGGCCTCTGCGGCGGCATCCACTCGGGCATGAGTCGCAAGATCCGCTCCATGTCC
CTCGAGAAGAATCAGCCCACCTTTGATCTCGCCATTATTGGCGAAAAGTGCAAGGCGCAGCTGCATCGCACAAAC
GGAAACCAAATCCAGCTGACCTTTGCCGGCGTGGGCAAGGACGTGCCCACCTTTGCCGACGCCCAGGCCATGGCC
GACCAAATCATGATGCTGCCTACCGAATACACAGACGTCAAGATTCTCTACAACAAGTTTATCAATGCCCAGAGC
TACGAGCCCACCTTTATCGAGGCTTTTTCCGAGGAGGCTATTGCCCAATCGCCAAACATCTCGGCTTTCGAGGTG
GACGATGAGGTTCTCGCCAATCTGCGCGAGTACAGCCTCGCCAACTCGCTCTACTGGGCTCTTGCCGAAGGCCAC
GCCTGCGAACAGTCTGCCCGAAGAAATGCCATGGACAATGCCTCCAAGAACGCCGGCAAGATGATCAACAAGTAC
CAGATTCTGTATAATCGCACCCGACAGGCCGTCATTACTGGAGAGTTGGTTGAAATCATCACTGGTGCTACCGCC
TCCGAGGACATGTAG
Gene >OphauB2|6345
ATGCTGTCTCGCACGGCTAGACCAGCTCTACGAGCTGCCACGGCCACACTGGCGGCCCCCCCATGGTGAGTTTAG
CCCGTACCGTACCTTTTCATGATTTATGCGTGATGCGTGATGCTTGATGTGCCCCCGAGCCTCAAGCCTCAAGCC
TCAATCCCAACAGCCGACTAACGCCACCTGTCCAAGGACTGCCACGGCTGCCGGCTATGCCACGCTTCGCGAAAT
CGACGCTCGCCGCAAGTCGATTCGCAACATTGAGAAAATCACAAAAACCATGAAGATTGTTGCTTCAACCAAGCT
CAACCGCGCTCAGCGCTCCATGGTGGAATCGCGCAAGTACGGCCAGACGTCCAACGAGGTTTTCGAAGCAGCCGA
GACCAAACCTACCGAGGCGGCTGAAGGCGCCGCCAAGACGCTCATCATTGTCTGCTCCTCGGACAAGGGCCTCTG
CGGCGGCATCCACTCGGGCATGAGTCGCAAGATCCGCTCCATGTCCCTCGAGAAGAATCAGCCCACCTTTGATCT
CGCCATTATTGGCGAAAAGTGCAAGGCGCAGCTGCATCGCACAAACGGAAACCAAATCCAGCTGACCTTTGCCGG
CGTGGGCAAGGACGTGCCCACCTTTGCCGACGCCCAGGCCATGGCCGACCAAATCATGATGCTGCCTACCGAATA
CACAGACGTCAAGATTCTCTACAACAAGTTTATCAATGCCCAGAGCTACGAGCCCACCTTTATCGAGGCTTTTTC
CGAGGAGGCTATTGCCCAATCGCGTATGTCGTCAGCCTGACGTAGCCCCCGTGCCGGAGCTGACGGTGCACCCTC
CTGGGGCCTTTTCTGTAGCAAACATCTCGGCTTTCGAGGTGGACGATGAGGTTCTCGCCAATCTGCGCGAGTACA
GCCTCGCCAACTCGCTCTACTGGGCTCTTGCCGAAGGCCACGCCTGCGAACAGTCTGCCCGAAGAAATGCCATGG
ACGTGAGTCGACTCTTCTTGTTGTCCCAGACACCTCTACTAGACCTTGTATTGCTAATCCACAGCTCGCAGAATG
CCTCCAAGAACGCCGGCAAGATGATCAACAAGTACCAGATTCTGTATAATCGCACCCGACAGGCCGTCATTACTG
GAGAGTTGGTTGAAATCATCACTGGTGCTACCGCCTCCGAGGACATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail