Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6344
Gene name
LocationContig_58:16257..19439
Strand-
Gene length (bp)3182
Transcript length (bp)2739
Coding sequence length (bp)2739
Protein length (aa) 913

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01028 Topoisom_I Eukaryotic DNA topoisomerase I, catalytic core 1.1E-95 500 730
PF02919 Topoisom_I_N Eukaryotic DNA topoisomerase I, DNA binding fragment 1.0E-93 270 496
PF14370 Topo_C_assoc C-terminal topoisomerase domain 1.3E-30 840 912

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00313|TOP1_CANAX DNA topoisomerase 1 OS=Candida albicans GN=TOP1 PE=3 SV=1 175 912 0.0E+00
sp|P04786|TOP1_YEAST DNA topoisomerase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOP1 PE=1 SV=2 266 912 0.0E+00
sp|P07799|TOP1_SCHPO DNA topoisomerase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=top1 PE=1 SV=2 203 908 0.0E+00
sp|A9Q1D5|TOP1M_PANTR DNA topoisomerase I, mitochondrial OS=Pan troglodytes GN=TOP1MT PE=2 SV=1 260 719 1.0E-148
sp|Q969P6|TOP1M_HUMAN DNA topoisomerase I, mitochondrial OS=Homo sapiens GN=TOP1MT PE=1 SV=1 260 719 1.0E-146
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00313|TOP1_CANAX DNA topoisomerase 1 OS=Candida albicans GN=TOP1 PE=3 SV=1 175 912 0.0E+00
sp|P04786|TOP1_YEAST DNA topoisomerase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOP1 PE=1 SV=2 266 912 0.0E+00
sp|P07799|TOP1_SCHPO DNA topoisomerase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=top1 PE=1 SV=2 203 908 0.0E+00
sp|A9Q1D5|TOP1M_PANTR DNA topoisomerase I, mitochondrial OS=Pan troglodytes GN=TOP1MT PE=2 SV=1 260 719 1.0E-148
sp|Q969P6|TOP1M_HUMAN DNA topoisomerase I, mitochondrial OS=Homo sapiens GN=TOP1MT PE=1 SV=1 260 719 1.0E-146
sp|Q6IM78|TOP1M_RAT DNA topoisomerase I, mitochondrial OS=Rattus norvegicus GN=Top1mt PE=2 SV=1 269 717 3.0E-142
sp|P11387|TOP1_HUMAN DNA topoisomerase 1 OS=Homo sapiens GN=TOP1 PE=1 SV=2 265 717 2.0E-141
sp|Q7YR26|TOP1_CHLAE DNA topoisomerase 1 OS=Chlorocebus aethiops GN=TOP1 PE=2 SV=1 265 717 6.0E-141
sp|Q8R4U6|TOP1M_MOUSE DNA topoisomerase I, mitochondrial OS=Mus musculus GN=Top1mt PE=2 SV=1 269 717 1.0E-139
sp|P41512|TOP1_XENLA DNA topoisomerase 1 OS=Xenopus laevis GN=top1 PE=2 SV=1 265 717 3.0E-139
sp|Q04750|TOP1_MOUSE DNA topoisomerase 1 OS=Mus musculus GN=Top1 PE=1 SV=2 265 717 3.0E-139
sp|Q9WUL0|TOP1_RAT DNA topoisomerase 1 OS=Rattus norvegicus GN=Top1 PE=1 SV=1 265 717 4.0E-139
sp|Q07050|TOP1_CRIGR DNA topoisomerase 1 OS=Cricetulus griseus GN=TOP1 PE=2 SV=1 265 717 5.0E-137
sp|P30181|TOP1_ARATH DNA topoisomerase 1 OS=Arabidopsis thaliana GN=TOP1 PE=1 SV=1 271 721 1.0E-130
sp|O17966|TOP1_CAEEL DNA topoisomerase 1 OS=Caenorhabditis elegans GN=top-1 PE=2 SV=1 254 713 3.0E-128
sp|Q54RC3|TOP1_DICDI DNA topoisomerase 1 OS=Dictyostelium discoideum GN=top1 PE=3 SV=1 271 900 7.0E-125
sp|P41511|TOP1_USTMA DNA topoisomerase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TOP1 PE=3 SV=2 271 882 8.0E-118
sp|P93119|TOP1_DAUCA DNA topoisomerase 1 OS=Daucus carota GN=TOP1 PE=2 SV=1 273 904 5.0E-110
sp|O17966|TOP1_CAEEL DNA topoisomerase 1 OS=Caenorhabditis elegans GN=top-1 PE=2 SV=1 824 901 6.0E-18
sp|P11387|TOP1_HUMAN DNA topoisomerase 1 OS=Homo sapiens GN=TOP1 PE=1 SV=2 828 912 8.0E-18
sp|Q7YR26|TOP1_CHLAE DNA topoisomerase 1 OS=Chlorocebus aethiops GN=TOP1 PE=2 SV=1 828 912 9.0E-18
sp|Q07050|TOP1_CRIGR DNA topoisomerase 1 OS=Cricetulus griseus GN=TOP1 PE=2 SV=1 828 912 9.0E-18
sp|Q9WUL0|TOP1_RAT DNA topoisomerase 1 OS=Rattus norvegicus GN=Top1 PE=1 SV=1 828 912 9.0E-18
sp|Q04750|TOP1_MOUSE DNA topoisomerase 1 OS=Mus musculus GN=Top1 PE=1 SV=2 828 912 9.0E-18
sp|A9Q1D5|TOP1M_PANTR DNA topoisomerase I, mitochondrial OS=Pan troglodytes GN=TOP1MT PE=2 SV=1 819 912 1.0E-16
sp|Q969P6|TOP1M_HUMAN DNA topoisomerase I, mitochondrial OS=Homo sapiens GN=TOP1MT PE=1 SV=1 819 912 1.0E-16
sp|P30189|TOP1_DROME DNA topoisomerase 1 OS=Drosophila melanogaster GN=Top1 PE=1 SV=1 830 901 2.0E-16
sp|Q6IM78|TOP1M_RAT DNA topoisomerase I, mitochondrial OS=Rattus norvegicus GN=Top1mt PE=2 SV=1 765 912 6.0E-14
sp|Q8R4U6|TOP1M_MOUSE DNA topoisomerase I, mitochondrial OS=Mus musculus GN=Top1mt PE=2 SV=1 765 912 2.0E-13
sp|P41512|TOP1_XENLA DNA topoisomerase 1 OS=Xenopus laevis GN=top1 PE=2 SV=1 812 894 4.0E-13
sp|P30181|TOP1_ARATH DNA topoisomerase 1 OS=Arabidopsis thaliana GN=TOP1 PE=1 SV=1 764 901 4.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003917 DNA topoisomerase type I (single strand cut, ATP-independent) activity Yes
GO:0006265 DNA topological change Yes
GO:0005488 binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016853 isomerase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003916 DNA topoisomerase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0140097 catalytic activity, acting on DNA No
GO:0006996 organelle organization No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0071103 DNA conformation change No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0051276 chromosome organization No
GO:0090304 nucleic acid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6344
MASDSSDDDLPLARTNGHVSSTTSLQCDDVAMTDKPGGGSTGLAGLSVRNGPLRGGRMNVDLPPTNGSNKRKSRS
SVSKINYRDASESDGEPLAKRSRPTKDVDSDSDDEPMGKSRTRKLPPSYKETALPQSSDDDQPLGIKLASKKAEI
EKKAAKEAKAIRAKEAKAQKKAIKDESDDDAPLSRTVSLKRQSNGGPGRKRLNGVKKEDSDSDAPIAKKAKAAAS
VKKTASSAAAREAKKSKASTKEPSEEEEEEEFEWWNAPKREDDTIKWQTLEHNGVLFAPEYEPLPKHVKLLYDGK
PVNLSKEAEEVATFWVAMMTPASLHHLDNPVFRNNFFRDFSDYMQKYGATDSNGNKLEIESLDKCDFSKIFNYWN
AKTEASKTKNLSKEEKEAAKAKKEALEAPYVYCLWDGRKQKVGNFRVEPPSLFRGRGEHPKTGRVKTRVMPEQIT
INIGKDAKVPEPPAGHKWKAVQHDQKATWLAMWQENINSAYKYVMLGAASDVKGQSDLKKFEKARELKKHIDKIR
KDYTRDLKSEIMADRQRATAMYLIDKLALRAGNEKDLQNEADTVGCCSLKYEHITLEPPDKVTFDFLGKDSIRYN
ETAHVDAQVFKNLKLFKKPPKGEGDDLFDRLTTSQLNKHLNSCMTGLTAKVFRTYNASFTMSELLKELHKDPRSK
GSIAEKVKLYNDCNRKVAILCNHKRTVGASHEQQMQKLGDRIKGLRYQKWRTKKMILDIDPTQKKKKGSAWFALD
ADLDETWIQEHQQFLVEEQRTKITKKFEKDNEKLKANKEKLLPDKELKERLQTVKELEQRFKKENKTGKVEAEGR
GPTVEKLLKTIEKLDERVKVLETQAEDRDGNKEVALGTSKINYIDPRLTVVFSKKFDVPIEKFFSKTLRDKFRWA
IKSVEDEKDWEF*
Coding >OphauB2|6344
ATGGCCTCTGACAGCTCCGACGACGACTTGCCCCTTGCGAGGACCAATGGCCACGTCTCGTCTACGACCTCACTA
CAATGCGACGATGTTGCCATGACAGACAAGCCTGGCGGCGGAAGTACCGGTTTAGCTGGCCTTTCGGTGCGCAAT
GGACCCCTCCGAGGCGGCCGCATGAATGTCGACTTGCCACCGACAAATGGGTCTAATAAACGCAAGTCGCGATCG
TCGGTTTCTAAAATCAACTACAGAGACGCCTCGGAGAGCGATGGGGAACCTCTGGCCAAACGCTCGAGGCCTACC
AAGGATGTCGACTCAGATTCGGATGACGAGCCCATGGGAAAATCTAGGACCAGAAAGCTCCCTCCTTCGTACAAG
GAAACCGCTCTGCCCCAGTCCTCGGATGACGACCAGCCTCTGGGCATCAAGCTTGCGAGCAAAAAGGCCGAGATT
GAGAAAAAGGCAGCAAAGGAGGCCAAGGCAATCCGAGCCAAGGAAGCAAAGGCCCAAAAGAAGGCAATCAAGGAT
GAATCAGATGACGACGCCCCTCTGTCCAGAACCGTGTCGCTAAAACGCCAGTCAAACGGCGGCCCTGGTAGAAAA
AGACTCAATGGAGTCAAAAAGGAAGACTCGGACTCTGATGCACCAATTGCTAAAAAGGCCAAGGCAGCAGCATCA
GTTAAAAAGACTGCTTCCTCAGCTGCCGCCAGGGAGGCTAAAAAGTCAAAGGCGAGCACCAAAGAGCCTAGTGAG
GAAGAGGAAGAAGAAGAATTCGAGTGGTGGAACGCACCAAAGCGCGAAGACGACACCATCAAGTGGCAGACTCTG
GAGCATAATGGAGTCCTCTTTGCTCCAGAATATGAGCCGCTTCCAAAGCACGTCAAGCTCCTCTACGATGGCAAA
CCTGTCAATCTCAGCAAGGAAGCCGAAGAGGTGGCTACCTTTTGGGTTGCCATGATGACTCCTGCTTCTTTGCAC
CACCTTGACAACCCCGTGTTTCGCAACAACTTTTTCCGAGATTTTTCGGATTACATGCAGAAGTACGGCGCCACA
GATAGCAACGGCAACAAGCTTGAGATTGAGAGCCTCGACAAGTGTGATTTTTCCAAAATATTCAATTATTGGAAT
GCCAAGACGGAAGCCAGCAAGACCAAGAACCTGTCCAAGGAGGAAAAGGAAGCTGCCAAGGCCAAGAAGGAGGCG
CTGGAGGCGCCCTATGTCTATTGCCTCTGGGATGGCAGGAAGCAAAAGGTGGGCAACTTTCGTGTGGAACCTCCT
AGTCTCTTTCGAGGTCGCGGCGAGCATCCCAAGACGGGACGCGTCAAGACTCGAGTCATGCCGGAGCAAATCACC
ATCAATATCGGCAAAGATGCCAAGGTGCCGGAACCTCCTGCCGGTCATAAGTGGAAGGCGGTGCAGCATGATCAG
AAAGCGACGTGGCTGGCCATGTGGCAGGAGAACATCAACAGTGCTTACAAGTATGTCATGCTGGGGGCTGCCAGC
GACGTCAAGGGACAGAGCGATTTGAAAAAATTCGAAAAGGCTCGTGAGCTCAAGAAGCACATTGATAAGATTCGC
AAGGACTACACGCGGGATCTCAAGAGCGAAATCATGGCCGATCGGCAAAGGGCAACAGCCATGTACTTGATTGAC
AAGCTAGCCCTCAGAGCTGGCAATGAAAAGGATTTGCAAAATGAAGCAGATACAGTGGGGTGTTGTTCTCTCAAG
TATGAGCACATCACTTTGGAGCCTCCAGACAAGGTCACTTTTGACTTTCTGGGAAAGGACAGCATCCGATACAAT
GAAACGGCCCACGTGGATGCTCAAGTCTTCAAGAACCTCAAACTCTTCAAGAAGCCCCCCAAGGGCGAGGGAGAT
GATTTGTTTGACCGCTTGACCACGTCACAGCTAAATAAGCACCTCAACAGCTGCATGACTGGCTTGACCGCCAAG
GTCTTTCGTACCTACAATGCCTCCTTCACAATGTCGGAGCTTCTCAAGGAGCTGCACAAAGACCCGCGTTCCAAG
GGCTCTATAGCTGAAAAGGTGAAGCTCTACAATGATTGCAACCGCAAGGTTGCCATTCTCTGCAATCACAAGAGA
ACTGTTGGCGCGAGCCACGAGCAGCAGATGCAGAAGCTCGGAGACAGGATCAAGGGGCTGCGATACCAGAAGTGG
CGGACTAAAAAGATGATTCTCGACATTGATCCGACGCAGAAAAAGAAGAAGGGCTCGGCCTGGTTTGCGCTCGAT
GCAGACTTGGATGAAACTTGGATTCAGGAGCATCAGCAGTTCTTGGTTGAGGAACAACGCACCAAGATTACTAAA
AAGTTTGAAAAGGACAATGAAAAACTCAAGGCAAACAAGGAGAAACTTTTGCCAGACAAGGAACTCAAGGAGCGG
CTGCAGACTGTCAAGGAGCTCGAGCAAAGATTTAAAAAGGAGAACAAGACTGGCAAAGTTGAGGCTGAGGGCCGA
GGTCCAACTGTTGAGAAGCTCCTCAAGACGATTGAGAAGCTGGATGAGCGGGTCAAGGTGCTGGAAACGCAGGCC
GAAGACCGCGATGGCAACAAGGAGGTTGCCCTGGGCACATCCAAGATTAACTACATTGATCCTCGTCTCACAGTT
GTCTTCTCAAAAAAGTTTGATGTGCCGATAGAAAAGTTCTTCTCCAAGACACTTCGCGATAAGTTTAGGTGGGCC
ATCAAGTCGGTGGAAGATGAGAAAGATTGGGAATTTTAG
Transcript >OphauB2|6344
ATGGCCTCTGACAGCTCCGACGACGACTTGCCCCTTGCGAGGACCAATGGCCACGTCTCGTCTACGACCTCACTA
CAATGCGACGATGTTGCCATGACAGACAAGCCTGGCGGCGGAAGTACCGGTTTAGCTGGCCTTTCGGTGCGCAAT
GGACCCCTCCGAGGCGGCCGCATGAATGTCGACTTGCCACCGACAAATGGGTCTAATAAACGCAAGTCGCGATCG
TCGGTTTCTAAAATCAACTACAGAGACGCCTCGGAGAGCGATGGGGAACCTCTGGCCAAACGCTCGAGGCCTACC
AAGGATGTCGACTCAGATTCGGATGACGAGCCCATGGGAAAATCTAGGACCAGAAAGCTCCCTCCTTCGTACAAG
GAAACCGCTCTGCCCCAGTCCTCGGATGACGACCAGCCTCTGGGCATCAAGCTTGCGAGCAAAAAGGCCGAGATT
GAGAAAAAGGCAGCAAAGGAGGCCAAGGCAATCCGAGCCAAGGAAGCAAAGGCCCAAAAGAAGGCAATCAAGGAT
GAATCAGATGACGACGCCCCTCTGTCCAGAACCGTGTCGCTAAAACGCCAGTCAAACGGCGGCCCTGGTAGAAAA
AGACTCAATGGAGTCAAAAAGGAAGACTCGGACTCTGATGCACCAATTGCTAAAAAGGCCAAGGCAGCAGCATCA
GTTAAAAAGACTGCTTCCTCAGCTGCCGCCAGGGAGGCTAAAAAGTCAAAGGCGAGCACCAAAGAGCCTAGTGAG
GAAGAGGAAGAAGAAGAATTCGAGTGGTGGAACGCACCAAAGCGCGAAGACGACACCATCAAGTGGCAGACTCTG
GAGCATAATGGAGTCCTCTTTGCTCCAGAATATGAGCCGCTTCCAAAGCACGTCAAGCTCCTCTACGATGGCAAA
CCTGTCAATCTCAGCAAGGAAGCCGAAGAGGTGGCTACCTTTTGGGTTGCCATGATGACTCCTGCTTCTTTGCAC
CACCTTGACAACCCCGTGTTTCGCAACAACTTTTTCCGAGATTTTTCGGATTACATGCAGAAGTACGGCGCCACA
GATAGCAACGGCAACAAGCTTGAGATTGAGAGCCTCGACAAGTGTGATTTTTCCAAAATATTCAATTATTGGAAT
GCCAAGACGGAAGCCAGCAAGACCAAGAACCTGTCCAAGGAGGAAAAGGAAGCTGCCAAGGCCAAGAAGGAGGCG
CTGGAGGCGCCCTATGTCTATTGCCTCTGGGATGGCAGGAAGCAAAAGGTGGGCAACTTTCGTGTGGAACCTCCT
AGTCTCTTTCGAGGTCGCGGCGAGCATCCCAAGACGGGACGCGTCAAGACTCGAGTCATGCCGGAGCAAATCACC
ATCAATATCGGCAAAGATGCCAAGGTGCCGGAACCTCCTGCCGGTCATAAGTGGAAGGCGGTGCAGCATGATCAG
AAAGCGACGTGGCTGGCCATGTGGCAGGAGAACATCAACAGTGCTTACAAGTATGTCATGCTGGGGGCTGCCAGC
GACGTCAAGGGACAGAGCGATTTGAAAAAATTCGAAAAGGCTCGTGAGCTCAAGAAGCACATTGATAAGATTCGC
AAGGACTACACGCGGGATCTCAAGAGCGAAATCATGGCCGATCGGCAAAGGGCAACAGCCATGTACTTGATTGAC
AAGCTAGCCCTCAGAGCTGGCAATGAAAAGGATTTGCAAAATGAAGCAGATACAGTGGGGTGTTGTTCTCTCAAG
TATGAGCACATCACTTTGGAGCCTCCAGACAAGGTCACTTTTGACTTTCTGGGAAAGGACAGCATCCGATACAAT
GAAACGGCCCACGTGGATGCTCAAGTCTTCAAGAACCTCAAACTCTTCAAGAAGCCCCCCAAGGGCGAGGGAGAT
GATTTGTTTGACCGCTTGACCACGTCACAGCTAAATAAGCACCTCAACAGCTGCATGACTGGCTTGACCGCCAAG
GTCTTTCGTACCTACAATGCCTCCTTCACAATGTCGGAGCTTCTCAAGGAGCTGCACAAAGACCCGCGTTCCAAG
GGCTCTATAGCTGAAAAGGTGAAGCTCTACAATGATTGCAACCGCAAGGTTGCCATTCTCTGCAATCACAAGAGA
ACTGTTGGCGCGAGCCACGAGCAGCAGATGCAGAAGCTCGGAGACAGGATCAAGGGGCTGCGATACCAGAAGTGG
CGGACTAAAAAGATGATTCTCGACATTGATCCGACGCAGAAAAAGAAGAAGGGCTCGGCCTGGTTTGCGCTCGAT
GCAGACTTGGATGAAACTTGGATTCAGGAGCATCAGCAGTTCTTGGTTGAGGAACAACGCACCAAGATTACTAAA
AAGTTTGAAAAGGACAATGAAAAACTCAAGGCAAACAAGGAGAAACTTTTGCCAGACAAGGAACTCAAGGAGCGG
CTGCAGACTGTCAAGGAGCTCGAGCAAAGATTTAAAAAGGAGAACAAGACTGGCAAAGTTGAGGCTGAGGGCCGA
GGTCCAACTGTTGAGAAGCTCCTCAAGACGATTGAGAAGCTGGATGAGCGGGTCAAGGTGCTGGAAACGCAGGCC
GAAGACCGCGATGGCAACAAGGAGGTTGCCCTGGGCACATCCAAGATTAACTACATTGATCCTCGTCTCACAGTT
GTCTTCTCAAAAAAGTTTGATGTGCCGATAGAAAAGTTCTTCTCCAAGACACTTCGCGATAAGTTTAGGTGGGCC
ATCAAGTCGGTGGAAGATGAGAAAGATTGGGAATTTTAG
Gene >OphauB2|6344
ATGGCCTCTGACAGCTCCGACGACGACTTGCCCCTTGCGAGGACCAATGGCCACGGTGAGTCTCGATTTTTTTCT
CCTGCTTTGCTCTCAACTTTGTCTTTCACCCCGGTACTGTGGGATTCATGCACAGTGGCGACTTGCACGCCCTTG
TTATGCCTCTTTTTTTTTTCCCTTTCTATACTCTGTCCTCTTCCCGCCGCACCTGATGATCACGGGCGTCGAGCG
TTGGATTGCTGACAATTATTGTACAAAGTCTCGTCTACGACCTCACTACAATGCGACGATGTTGCCATGACAGAC
AAGCCTGGCGGCGGAAGTACCGGTTTAGCTGGCCTTTCGGTGCGCAATGGACCCCTCCGAGGCGGCCGCATGAAT
GTCGACTTGCCACCGACAAATGGGTCTAATAAACGCAAGTCGCGATCGTCGGTTTCTAAAATCAACTACAGAGAC
GCCTCGGAGAGCGATGGGGAACCTCTGGTAAGACCTGCACTGTGCTGCTCCATTTGGTAGTATCTGTCAGCGTGA
TGCTGACAGCTGCACGTACAGGCCAAACGCTCGAGGCCTACCAAGGATGTCGACTCAGATTCGGATGACGAGCCC
ATGGGAAAATCTAGGACCAGAAAGCTCCCTCCTTCGTACAAGGAAACCGCTCTGCCCCAGTCCTCGGATGACGAC
CAGCCTCTGGGCATCAAGCTTGCGAGCAAAAAGGCCGAGATTGAGAAAAAGGCAGCAAAGGAGGCCAAGGCAATC
CGAGCCAAGGAAGCAAAGGCCCAAAAGAAGGCAATCAAGGATGAATCAGATGACGACGCCCCTCTGTCCAGAACC
GTGTCGCTAAAACGCCAGTCAAACGGCGGCCCTGGTAGAAAAAGACTCAATGGAGTCAAAAAGGAAGACTCGGAC
TCTGATGCACCAATTGCTAAAAAGGCCAAGGCAGCAGCATCAGTTAAAAAGACTGCTTCCTCAGCTGCCGCCAGG
GAGGCTAAAAAGTCAAAGGCGAGCACCAAAGAGCCTAGTGAGGAAGAGGAAGAAGAAGAATTCGAGTGGTGGAAC
GCACCAAAGCGCGAAGACGACACCATCAAGTGGCAGACTCTGGAGCATAATGGAGTCCTCTTTGCTCCAGAATAT
GAGCCGCTTCCAAAGCACGTCAAGCTCCTCTACGATGGCAAACCTGTCAATCTCAGCAAGGAAGCCGAAGAGGTG
GCTACCTTTTGGGTTGCCATGATGACTCCTGCTTCTTTGCACCACCTTGACAACCCCGTGTTTCGCAACAACTTT
TTCCGAGATTTTTCGGATTACATGCAGAAGTACGGCGCCACAGATAGCAACGGCAACAAGCTTGAGATTGAGAGC
CTCGACAAGTGTGATTTTTCCAAAATATTCAATTATTGGAATGCCAAGACGGAAGCCAGCAAGACCAAGAACCTG
TCCAAGGAGGAAAAGGAAGCTGCCAAGGCCAAGAAGGAGGCGCTGGAGGCGCCCTATGTCTATTGCCTCTGGGAT
GGCAGGAAGCAAAAGGTGGGCAACTTTCGTGTGGAACCTCCTAGTCTCTTTCGAGGTCGCGGCGAGCATCCCAAG
ACGGGACGCGTCAAGACTCGAGTCATGCCGGAGCAAATCACCATCAATATCGGCAAAGATGCCAAGGTGCCGGAA
CCTCCTGCCGGTCATAAGTGGAAGGCGGTGCAGCATGATCAGAAAGCGACGTGGCTGGCCATGTGGCAGGAGAAC
ATCAACAGTGCTTACAAGTATGTCATGCTGGGGGCTGCCAGCGACGTCAAGGGACAGAGCGATTTGAAAAAATTC
GAAAAGGCTCGTGAGCTCAAGAAGCACATTGATAAGATTCGCAAGGACTACACGCGGGATCTCAAGAGCGAAATC
ATGGCCGATCGGCAAAGGGCAACAGCCATGTACTTGATTGACAAGCTAGCCCTCAGAGCTGGCAATGAAAAGGAT
TTGCAAAATGAAGCAGATACAGTGGGGTGTTGTTCTCTCAAGTATGAGCACATCACTTTGGAGCCTCCAGACAAG
GTCACTTTTGACTTTCTGGGAAAGGACAGCATCCGATACAATGAAACGGCCCACGTGGATGCTCAAGTCTTCAAG
AACCTCAAACTCTTCAAGAAGCCCCCCAAGGGCGAGGGAGATGATTTGTTTGACCGCTTGACCGTGAGTTGACGA
GGACTGGCTAGAATGGTTTACACAAGGTGCTGACTTGAGATTCTAGACGTCACAGCTAAATAAGCACCTCAACAG
CTGCATGACTGGCTTGACCGCCAAGGTCTTTCGTACCTACAATGCCTCCTTCACAATGTCGGAGCTTCTCAAGGA
GCTGCACAAAGACCCGCGTTCCAAGGGCTCTATAGCTGAAAAGGTGAAGCTCTACAATGATTGCAACCGCAAGGT
TGCCATTCTCTGCAATCACAAGAGAACTGTTGGCGCGAGCCACGAGCAGCAGATGCAGAAGCTCGGAGACAGGGT
ATGTCGATGTCGCAATGCCTCATTTGTTGTAATTTGATACTAAAGCCATGGATAGATCAAGGGGCTGCGATACCA
GAAGTGGCGGACTAAAAAGATGATTCTCGACATTGATCCGACGCAGAAAAAGAAGAAGGGCTCGGCCTGGTTTGC
GCTCGATGCAGACTTGGATGAAACTTGGATTCAGGAGCATCAGCAGTTCTTGGTTGAGGAACAACGCACCAAGAT
TACTAAAAAGTTTGAAAAGGACAATGAAAAACTCAAGGCAAACAAGGAGAAACTTTTGCCAGACAAGGAACTCAA
GGAGCGGCTGCAGACTGTCAAGGAGCTCGAGCAAAGATTTAAAAAGGAGAACAAGACTGGCAAAGTTGAGGCTGA
GGGCCGAGGTCCAACTGTTGAGAAGCTCCTCAAGACGATTGAGAAGCTGGATGAGCGGGTCAAGGTGCTGGAAAC
GCAGGCCGAAGACCGCGATGGCAACAAGGAGGTTGCCCTGGGCACATCCAAGATTGTAAGCTGGCGTGTCAAGTT
TTTTGCTTCCCAGCCATGGTGATGCTAACCGCAGCCGATAGAACTACATTGATCCTCGTCTCACAGTTGTCTTCT
CAAAAAAGTTTGATGTGCCGATAGAAAAGTTCTTCTCCAAGACACTTCGCGATAAGTTTAGGTGGGCCATCAAGT
CGGTGGAAGATGAGAAAGATTGGGAATTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail