Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6343
Gene name
LocationContig_58:14246..15453
Strand+
Gene length (bp)1207
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 3.5E-36 59 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 17 359 3.0E-78
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 16 263 3.0E-70
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 1 274 2.0E-68
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 1 274 3.0E-66
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 2 268 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 17 359 3.0E-78
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 16 263 3.0E-70
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 1 274 2.0E-68
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 1 274 3.0E-66
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 2 268 2.0E-61
sp|Q5AK54|CRH12_CANAL Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH12 PE=1 SV=1 21 269 5.0E-44
sp|Q05790|CRR1_YEAST Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRR1 PE=2 SV=1 40 245 4.0E-25
sp|Q75A41|CRR1_ASHGO Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CRR1 PE=3 SV=1 83 245 1.0E-23
sp|Q4WI46|CRF2_ASPFU Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=1 54 227 3.0E-22
sp|Q5AJC0|UTR2_CANAL Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTR2 PE=1 SV=1 77 256 4.0E-22
sp|P32623|CRH2_YEAST Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR2 PE=1 SV=3 77 244 1.0E-16
sp|O80803|XTH17_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 17 OS=Arabidopsis thaliana GN=XTH17 PE=1 SV=1 72 241 2.0E-09
sp|P24806|XTH24_ARATH Xyloglucan endotransglucosylase/hydrolase protein 24 OS=Arabidopsis thaliana GN=XTH24 PE=1 SV=2 84 273 2.0E-08
sp|Q9FI31|XTH20_ARATH Xyloglucan endotransglucosylase/hydrolase protein 20 OS=Arabidopsis thaliana GN=XTH20 PE=2 SV=1 83 241 2.0E-08
sp|Q9M0D2|XTH18_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 18 OS=Arabidopsis thaliana GN=XTH18 PE=2 SV=1 72 241 7.0E-08
sp|Q9M0D1|XTH19_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 19 OS=Arabidopsis thaliana GN=XTH19 PE=2 SV=1 72 241 1.0E-07
sp|P37073|GUB_BREBE Beta-glucanase OS=Brevibacillus brevis GN=bglBB PE=1 SV=1 67 207 2.0E-07
sp|Q9ZV40|XTH21_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 21 OS=Arabidopsis thaliana GN=XTH21 PE=2 SV=1 84 224 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 357 379 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6343
MRRFAALALLSTRALAQTYSQCNPLNTQCPANTALGKSINVDFRKGAVNSFGASGSPSYGSDGVSFTVAKGGDAP
QLNSIFYIMYGRVDVTLKAAPGPGIVSSVVLESDDLDEIDLEWLGANPDEVQSNYFGKGRTTTYNRGRFHRLDGT
QTRLVTYTIDWTQDRIVWMSTADSKPLRTLHRPDATDAGVDEYPQTPMRVKFGAWAGGDAAHNAPGTVEWARGPT
DYQRGPFSMLVESIRITDYSTGSEYRYADNSGSADSIQAVGGAVNANYNSRNALSVTAAPAPSLPTPTGLAAALA
YVPRGGIGHDDNNPSPTRTQTGWPWVAGATPTGGSIPSGWYMTSEGKIMRSSASDAACHLACSSFLFALSFAAGL
VLVLCSR*
Coding >OphauB2|6343
ATGCGTCGATTCGCCGCCCTTGCTCTGCTCTCGACTCGGGCTTTGGCTCAGACATACAGCCAATGCAATCCCCTC
AACACCCAATGCCCAGCCAACACAGCCCTCGGCAAGTCCATCAATGTCGACTTTCGCAAGGGCGCCGTCAACTCG
TTTGGCGCCTCTGGCTCGCCCTCGTATGGCTCCGACGGCGTCTCCTTCACCGTGGCCAAGGGCGGCGATGCGCCC
CAGCTCAACTCCATCTTCTACATCATGTACGGCCGCGTCGACGTGACGCTCAAGGCTGCTCCCGGGCCCGGCATT
GTGTCGTCGGTGGTGCTCGAGTCGGACGACCTGGATGAAATCGACCTCGAGTGGCTCGGCGCAAACCCAGACGAG
GTGCAGTCAAACTACTTTGGCAAGGGCCGCACCACGACGTACAACCGCGGCCGCTTCCATCGCCTCGACGGCACC
CAGACGCGCCTCGTCACCTACACCATTGACTGGACCCAGGACCGCATCGTCTGGATGTCCACGGCCGATTCCAAG
CCCCTGCGCACCCTCCATCGCCCCGACGCCACAGACGCCGGCGTCGACGAGTATCCCCAGACCCCCATGCGAGTC
AAGTTTGGCGCCTGGGCCGGCGGCGACGCTGCCCACAATGCCCCCGGCACTGTCGAATGGGCCCGCGGCCCTACC
GACTACCAGCGCGGCCCCTTTTCCATGCTCGTCGAGTCGATCCGCATTACCGACTACTCCACCGGCTCCGAGTAC
CGCTATGCCGACAACTCGGGCTCCGCCGACTCCATCCAGGCCGTCGGCGGTGCTGTCAATGCCAACTACAACAGT
CGTAACGCCCTCTCCGTCACGGCTGCCCCAGCCCCTTCGCTGCCCACCCCTACTGGCCTCGCCGCCGCCCTGGCC
TATGTGCCCCGCGGCGGCATCGGCCACGACGACAACAATCCCTCTCCCACCCGCACCCAGACTGGCTGGCCCTGG
GTCGCCGGCGCCACCCCAACCGGCGGCTCCATCCCCTCGGGCTGGTACATGACGTCCGAGGGCAAGATTATGCGC
AGCAGCGCCTCTGATGCCGCCTGCCATCTTGCCTGCTCCTCTTTCCTGTTCGCCCTATCCTTTGCCGCTGGCCTT
GTCCTTGTGCTCTGCTCTCGCTGA
Transcript >OphauB2|6343
ATGCGTCGATTCGCCGCCCTTGCTCTGCTCTCGACTCGGGCTTTGGCTCAGACATACAGCCAATGCAATCCCCTC
AACACCCAATGCCCAGCCAACACAGCCCTCGGCAAGTCCATCAATGTCGACTTTCGCAAGGGCGCCGTCAACTCG
TTTGGCGCCTCTGGCTCGCCCTCGTATGGCTCCGACGGCGTCTCCTTCACCGTGGCCAAGGGCGGCGATGCGCCC
CAGCTCAACTCCATCTTCTACATCATGTACGGCCGCGTCGACGTGACGCTCAAGGCTGCTCCCGGGCCCGGCATT
GTGTCGTCGGTGGTGCTCGAGTCGGACGACCTGGATGAAATCGACCTCGAGTGGCTCGGCGCAAACCCAGACGAG
GTGCAGTCAAACTACTTTGGCAAGGGCCGCACCACGACGTACAACCGCGGCCGCTTCCATCGCCTCGACGGCACC
CAGACGCGCCTCGTCACCTACACCATTGACTGGACCCAGGACCGCATCGTCTGGATGTCCACGGCCGATTCCAAG
CCCCTGCGCACCCTCCATCGCCCCGACGCCACAGACGCCGGCGTCGACGAGTATCCCCAGACCCCCATGCGAGTC
AAGTTTGGCGCCTGGGCCGGCGGCGACGCTGCCCACAATGCCCCCGGCACTGTCGAATGGGCCCGCGGCCCTACC
GACTACCAGCGCGGCCCCTTTTCCATGCTCGTCGAGTCGATCCGCATTACCGACTACTCCACCGGCTCCGAGTAC
CGCTATGCCGACAACTCGGGCTCCGCCGACTCCATCCAGGCCGTCGGCGGTGCTGTCAATGCCAACTACAACAGT
CGTAACGCCCTCTCCGTCACGGCTGCCCCAGCCCCTTCGCTGCCCACCCCTACTGGCCTCGCCGCCGCCCTGGCC
TATGTGCCCCGCGGCGGCATCGGCCACGACGACAACAATCCCTCTCCCACCCGCACCCAGACTGGCTGGCCCTGG
GTCGCCGGCGCCACCCCAACCGGCGGCTCCATCCCCTCGGGCTGGTACATGACGTCCGAGGGCAAGATTATGCGC
AGCAGCGCCTCTGATGCCGCCTGCCATCTTGCCTGCTCCTCTTTCCTGTTCGCCCTATCCTTTGCCGCTGGCCTT
GTCCTTGTGCTCTGCTCTCGCTGA
Gene >OphauB2|6343
ATGCGTCGATTCGCCGCCCTTGCTCTGCTCTCGACTCGGGCTTTGGCTCAGACATACAGCCAATGCAATCCCCTC
AACAGTATTGACCGACCCCGCCAGAGCTCCTTGGCCCAAGCTAACCCTTGGCCGCTGCCCAGCCCAATGCCCAGC
CAACACAGCCCTCGGCAAGTCCATCAATGTCGACTTTCGCAAGGGCGCCGTCAACTCGTTTGGCGCCTCTGGCTC
GCCCTCGTATGGCTCCGACGGCGTCTCCTTCACCGTGGCCAAGGGCGGCGATGCGCCCCAGCTCAACTCCATCTT
CTACATCATGTACGGCCGCGTCGACGTGACGCTCAAGGCTGCTCCCGGGCCCGGCATTGTGTCGTCGGTGGTGCT
CGAGTCGGACGACCTGGATGAAATCGACCTCGAGTGGCTCGGCGCAAACCCAGACGAGGTGCAGTCAAACTACTT
TGGCAAGGGCCGCACCACGACGTACAACCGCGGCCGCTTCCATCGCCTCGACGGCACCCAGACGCGCCTCGTCAC
CTACACCATTGACTGGACCCAGGACCGCATCGTCTGGATGTCCACGGCCGATTCCAAGCCCCTGCGCACCCTCCA
TCGCCCCGACGCCACAGACGCCGGCGTCGACGAGTATCCCCAGACCCCCATGCGAGTCAAGTTTGGCGCCTGGGC
CGGCGGCGACGCTGCCCACAATGCCCCCGGCACTGTCGAATGGGCCCGCGGCCCTACCGACTACCAGCGCGGCCC
CTTTTCCATGCTCGTCGAGTCGATCCGCATTACCGACTACTCCACCGGCTCCGAGTACCGCTATGCCGACAACTC
GGGCTCCGCCGACTCCATCCAGGCCGTCGGCGGTGCTGTCAATGCCAACTACAACAGTCGTAACGCCCTCTCCGT
CACGGCTGCCCCAGCCCCTTCGCTGCCCACCCCTACTGGCCTCGCCGCCGCCCTGGCCTATGTGCCCCGCGGCGG
CATCGGCCACGACGACAACAATCCCTCTCCCACCCGCACCCAGACTGGCTGGCCCTGGGTCGCCGGCGCCACCCC
AACCGGCGGCTCCATCCCCTCGGGCTGGTACATGACGTCCGAGGGCAAGATTATGCGCAGCAGCGCCTCTGATGC
CGCCTGCCATCTTGCCTGCTCCTCTTTCCTGTTCGCCCTATCCTTTGCCGCTGGCCTTGTCCTTGTGCTCTGCTC
TCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail