Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6341
Gene name
LocationContig_571:479..994
Strand-
Gene length (bp)515
Transcript length (bp)399
Coding sequence length (bp)399
Protein length (aa) 133

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01694 Rhomboid Rhomboid family 7.4E-07 58 108

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q4I4A4|RBD2_GIBZE Rhomboid protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RBD2 PE=3 SV=1 2 131 2.0E-39
sp|Q874X5|RBD2_PODAS Rhomboid protein 2 OS=Podospora anserina GN=RBD2 PE=3 SV=1 2 131 9.0E-38
sp|Q7S4V5|RBD2_NEUCR Rhomboid protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rbd-2 PE=3 SV=1 15 131 1.0E-33
sp|Q4WLP9|RBD2_ASPFU Rhomboid protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rbd2 PE=3 SV=1 15 131 2.0E-30
sp|Q9P375|YLM6_SCHPO Uncharacterized rhomboid protein C19B12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19B12.06c PE=3 SV=2 14 116 3.0E-08

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0016021 integral component of membrane Yes
GO:0003824 catalytic activity No
GO:0008236 serine-type peptidase activity No
GO:0110165 cellular anatomical entity No
GO:0017171 serine hydrolase activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008233 peptidase activity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0140096 catalytic activity, acting on a protein No
GO:0004175 endopeptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19
2 95 117 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6341
MPGIRDLNASSFWIFIQRLPLVTRIIILLITLCWMVGLYWQKLSDWGSLVPSKVFLTSAYRLSTFPLIHKNLTHA
VVNVLALTPLMERFENEYGSLSTLALFFGPLTSLPALLYVLLEGTILRGNKPVMGAR*
Coding >OphauB2|6341
ATGCCTGGCATTCGAGACCTTAACGCTTCTAGTTTCTGGATTTTCATTCAGCGGCTACCACTCGTTACTCGAATC
ATAATATTACTGATTACTCTTTGCTGGATGGTTGGCCTCTACTGGCAAAAACTAAGCGACTGGGGGTCTTTGGTT
CCGAGCAAAGTATTCTTAACATCAGCATATCGATTATCGACATTTCCTCTAATCCATAAAAACCTAACCCACGCT
GTGGTCAACGTGCTTGCCTTAACGCCCTTAATGGAAAGATTTGAGAATGAATACGGGTCATTATCTACACTCGCG
TTGTTCTTTGGACCTCTAACATCACTTCCAGCTCTCTTATATGTCTTACTTGAAGGAACAATTTTGCGAGGAAAT
AAACCAGTCATGGGAGCAAGGTGA
Transcript >OphauB2|6341
ATGCCTGGCATTCGAGACCTTAACGCTTCTAGTTTCTGGATTTTCATTCAGCGGCTACCACTCGTTACTCGAATC
ATAATATTACTGATTACTCTTTGCTGGATGGTTGGCCTCTACTGGCAAAAACTAAGCGACTGGGGGTCTTTGGTT
CCGAGCAAAGTATTCTTAACATCAGCATATCGATTATCGACATTTCCTCTAATCCATAAAAACCTAACCCACGCT
GTGGTCAACGTGCTTGCCTTAACGCCCTTAATGGAAAGATTTGAGAATGAATACGGGTCATTATCTACACTCGCG
TTGTTCTTTGGACCTCTAACATCACTTCCAGCTCTCTTATATGTCTTACTTGAAGGAACAATTTTGCGAGGAAAT
AAACCAGTCATGGGAGCAAGGTGA
Gene >OphauB2|6341
ATGCCTGGCATTCGAGACCTTAACGCTTCTAGTTTCTGGATTTTCATTCAGCGGCTACCACTCGTTACTCGAATC
ATAATATTACTGATTACTCTTTGCTGGATGGTTGGCCTCTACTGGCAAAAACTAAGCGACTGGGGGTCTTTGGTT
CCGAGCAAAGTATTCTTAACATCAGGTCAGTGCTTTTCAAGCGTTTTGCTTCAGGCACGTCCTAATTATATTGGC
TTTAGCATATCGATTATCGACATTTCCTCTAATCCATAAAAACCTAACCCACGCTGTGGTCAACGTGCTTGCCTT
AACGCCCTTAATGGAAAGATTTGAGAATGAATACGGGTCATTATCTACACTCGCGTTGTTCTTTGGACGTATGAG
AATGCTTTGCTTGACTGCTAAGATTTATAGTCAACTAATAATATTTGGCACCAGCTCTAACATCACTTCCAGCTC
TCTTATATGTCTTACTTGAAGGAACAATTTTGCGAGGAAATAAACCAGTCATGGGAGCAAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail