Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6340
Gene name
LocationContig_57:101750..113686
Strand-
Gene length (bp)11936
Transcript length (bp)11730
Coding sequence length (bp)11730
Protein length (aa) 3910

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 3.9E-69 311 713
PF00501 AMP-binding AMP-binding enzyme 1.2E-61 1840 2234
PF00501 AMP-binding AMP-binding enzyme 3.1E-70 2853 3253
PF00668 Condensation Condensation domain 5.0E-19 933 1108
PF00668 Condensation Condensation domain 4.1E-08 1191 1356
PF00668 Condensation Condensation domain 1.7E-35 1395 1818
PF00668 Condensation Condensation domain 9.0E-30 2471 2745
PF07993 NAD_binding_4 Male sterility protein 4.8E-39 3531 3757
PF00550 PP-binding Phosphopantetheine attachment site 4.1E-11 845 907
PF00550 PP-binding Phosphopantetheine attachment site 1.9E-13 2368 2431
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-04 3426 3464
PF01370 Epimerase NAD dependent epimerase/dehydratase family 7.1E-10 3529 3710

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 115 2899 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1770 3462 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 263 3385 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 289 2758 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1340 3354 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 115 2899 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1770 3462 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 263 3385 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 289 2758 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1340 3354 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 866 2741 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 117 1736 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 287 2336 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1574 3477 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 113 1797 0.0E+00
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 221 3824 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 246 3468 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 304 2719 0.0E+00
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 295 3356 0.0E+00
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1768 2741 0.0E+00
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 310 2431 2.0E-179
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 107 2742 6.0E-179
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 254 2448 9.0E-172
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 304 2414 3.0E-170
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 102 2767 1.0E-169
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 309 2428 6.0E-151
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1833 3357 8.0E-145
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1394 2640 8.0E-142
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1394 2762 5.0E-140
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1830 2744 5.0E-140
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1394 2762 7.0E-140
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1830 2744 8.0E-139
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1394 2740 3.0E-138
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1388 3360 3.0E-137
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1392 2542 6.0E-137
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1830 2741 5.0E-136
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 288 910 9.0E-134
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1398 3378 2.0E-133
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1394 3366 3.0E-133
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1393 3356 5.0E-133
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1393 3356 5.0E-132
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1382 2740 1.0E-129
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1509 3466 1.0E-126
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1398 3482 2.0E-126
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2826 3360 5.0E-126
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1364 2740 7.0E-125
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1393 3356 2.0E-123
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 747 2425 9.0E-123
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1394 2662 5.0E-120
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1509 3356 2.0E-117
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1509 3356 4.0E-116
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1391 3356 5.0E-116
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1827 2740 9.0E-116
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1394 3477 2.0E-115
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1391 3356 1.0E-113
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 290 1082 1.0E-113
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1393 2543 3.0E-112
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 256 911 2.0E-111
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1391 3487 2.0E-108
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 273 906 3.0E-106
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 89 906 4.0E-106
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 197 930 1.0E-105
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1827 2740 1.0E-105
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1830 2746 2.0E-105
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 89 917 8.0E-105
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 304 901 1.0E-104
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 304 901 1.0E-104
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 89 917 2.0E-104
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1842 3357 2.0E-104
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2813 3356 2.0E-104
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 304 991 6.0E-104
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 284 906 8.0E-104
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1626 2532 1.0E-103
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 237 985 2.0E-103
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 290 1144 7.0E-102
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2669 3485 1.0E-101
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1393 2763 2.0E-101
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2695 3358 2.0E-101
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1509 3356 2.0E-101
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1391 3356 3.0E-101
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1830 3356 5.0E-101
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2460 3363 1.0E-100
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 301 919 3.0E-100
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1391 3487 6.0E-100
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 296 1378 2.0E-99
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 104 1111 8.0E-99
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 260 1346 1.0E-98
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1852 3368 2.0E-98
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2814 3423 1.0E-97
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 243 1382 2.0E-97
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1818 3356 1.0E-96
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 244 1355 3.0E-96
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1774 2441 3.0E-95
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2458 3449 7.0E-95
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 310 1377 9.0E-95
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1386 2719 1.0E-94
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1845 3356 1.0E-94
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2848 3357 9.0E-94
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2848 3357 1.0E-93
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2828 3466 1.0E-93
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 269 1086 2.0E-93
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 304 998 2.0E-93
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2473 3457 2.0E-93
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 310 1365 7.0E-92
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 310 1365 1.0E-91
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2848 3357 3.0E-91
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 304 1365 7.0E-91
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 304 1365 1.0E-90
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 303 1091 1.0E-90
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 243 1346 3.0E-90
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2764 3357 4.0E-90
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2767 3371 4.0E-90
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2764 3357 5.0E-90
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1392 2719 6.0E-89
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 206 1365 8.0E-89
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2846 3457 2.0E-87
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2795 3358 2.0E-87
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1392 2741 9.0E-87
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1392 2741 2.0E-86
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1394 2719 3.0E-86
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2467 3356 2.0E-85
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 240 1274 6.0E-85
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2467 3356 7.0E-85
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2848 3403 2.0E-84
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 279 1378 3.0E-84
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1396 2659 3.0E-84
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2423 3471 1.0E-83
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2467 3356 6.0E-83
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1392 2745 6.0E-82
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2776 3466 9.0E-80
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 155 1189 1.0E-79
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2400 3466 1.0E-79
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1386 2410 2.0E-79
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 256 822 3.0E-79
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2467 3365 3.0E-79
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1414 2643 1.0E-78
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 238 1222 5.0E-78
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1391 2743 6.0E-78
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 259 1365 3.0E-77
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1789 2741 5.0E-77
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1392 2431 5.0E-77
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 92 907 3.0E-76
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2814 3450 4.0E-76
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1393 2756 1.0E-75
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 304 1145 1.0E-75
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 304 1101 2.0E-75
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 126 1098 2.0E-73
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 241 1220 2.0E-73
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 241 1220 2.0E-73
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 126 1098 7.0E-73
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 245 1219 1.0E-72
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1435 2743 3.0E-72
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 262 921 9.0E-72
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 320 1224 9.0E-72
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 243 1112 2.0E-69
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2871 3841 2.0E-69
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1362 2721 6.0E-69
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1858 2746 9.0E-69
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2861 3841 1.0E-68
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1509 2767 3.0E-68
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 303 1125 7.0E-68
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 209 1079 7.0E-68
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1391 2427 9.0E-68
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 114 1101 1.0E-67
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 273 1077 1.0E-67
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1393 2745 1.0E-67
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 223 1145 3.0E-67
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 309 1152 5.0E-67
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2786 3482 5.0E-67
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1391 2432 8.0E-67
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 311 1108 1.0E-66
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1388 2431 2.0E-66
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2798 3365 5.0E-66
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1438 2742 7.0E-66
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 117 1121 8.0E-66
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 222 1104 1.0E-65
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1372 2744 2.0E-65
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1391 2431 2.0E-65
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2801 3841 2.0E-65
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 292 1125 3.0E-65
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 227 1109 3.0E-65
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 260 911 4.0E-65
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 254 1170 4.0E-65
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 242 1103 5.0E-65
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 239 1079 5.0E-65
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1393 2425 6.0E-65
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 302 1139 1.0E-64
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2843 3358 1.0E-64
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1441 2429 3.0E-64
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1435 2428 4.0E-64
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 121 907 6.0E-64
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 273 1102 1.0E-63
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 304 1105 1.0E-63
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 242 1125 2.0E-63
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 242 1125 2.0E-63
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1609 2741 2.0E-63
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1439 2643 3.0E-63
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1420 2434 4.0E-63
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2872 3826 5.0E-63
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 217 920 5.0E-63
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1398 2744 9.0E-63
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 244 1152 2.0E-62
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 113 1170 3.0E-62
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1830 2738 4.0E-62
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 309 909 1.0E-61
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1507 2645 1.0E-61
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 170 1078 1.0E-61
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2837 3356 2.0E-61
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 243 1098 2.0E-61
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 254 1170 4.0E-61
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2837 3363 4.0E-61
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1379 2744 5.0E-61
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2837 3363 6.0E-61
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 154 1085 7.0E-61
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1435 2743 8.0E-61
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 237 1080 9.0E-61
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2756 3356 1.0E-60
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2845 3356 2.0E-60
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1804 2656 3.0E-60
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2846 3841 5.0E-60
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1508 2428 1.0E-59
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 240 1119 1.0E-59
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1593 2738 1.0E-59
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 255 917 3.0E-59
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1391 2644 3.0E-59
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 289 1139 5.0E-59
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 245 921 5.0E-59
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 223 1101 5.0E-59
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2843 3377 5.0E-59
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 240 1121 8.0E-59
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 224 920 9.0E-59
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 239 921 1.0E-58
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1712 2740 1.0E-58
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1610 2722 1.0E-58
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2329 3356 1.0E-58
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 294 881 2.0E-58
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1509 2721 2.0E-58
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1509 2721 2.0E-58
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1712 2740 2.0E-58
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 302 906 4.0E-58
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 967 1354 4.0E-58
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2797 3457 1.0E-57
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 310 1086 1.0E-57
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2786 3457 1.0E-57
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2784 3378 1.0E-57
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2377 3356 2.0E-57
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 227 1104 2.0E-57
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2814 3365 2.0E-57
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2786 3356 2.0E-57
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1521 2430 3.0E-57
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 310 1086 5.0E-57
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2843 3707 1.0E-56
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 278 1078 1.0E-56
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 278 1078 2.0E-56
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1397 2661 2.0E-56
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2814 3378 3.0E-56
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1397 2661 3.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2749 3467 4.0E-56
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1395 2431 5.0E-56
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1830 2442 1.0E-55
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1395 2743 2.0E-55
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2813 3356 2.0E-55
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1830 2738 3.0E-55
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 222 926 4.0E-55
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1391 2715 4.0E-55
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1439 2431 5.0E-55
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1830 2442 5.0E-55
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 223 911 5.0E-55
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 278 906 7.0E-55
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2795 3356 1.0E-54
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 279 1105 2.0E-54
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2786 3356 2.0E-54
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2804 3360 2.0E-54
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2766 3374 2.0E-54
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2814 3478 4.0E-54
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2783 3370 4.0E-54
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 305 1097 5.0E-54
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1438 2726 7.0E-54
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2833 3360 7.0E-54
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2833 3487 1.0E-53
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 308 910 2.0E-53
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2795 3356 3.0E-53
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1396 2743 4.0E-53
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1436 2532 4.0E-53
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2870 3457 4.0E-53
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2796 3356 4.0E-53
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2837 3356 4.0E-53
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2872 3841 6.0E-53
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2797 3376 1.0E-52
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2813 3295 2.0E-52
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1401 2740 2.0E-52
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1424 2717 3.0E-52
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1842 2430 3.0E-52
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 309 1124 4.0E-52
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2786 3352 6.0E-52
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1380 2438 2.0E-51
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2844 3356 2.0E-51
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1348 2441 5.0E-51
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1398 2428 6.0E-51
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2799 3352 7.0E-51
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2835 3356 2.0E-50
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1784 2667 3.0E-50
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1440 2425 4.0E-50
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1396 2257 6.0E-50
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2825 3370 9.0E-50
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 330 1045 1.0E-49
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2844 3467 2.0E-49
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 307 985 3.0E-49
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1495 2428 4.0E-49
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2834 3818 4.0E-49
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2797 3365 5.0E-49
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1391 2606 7.0E-49
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 115 906 8.0E-49
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2782 3356 8.0E-49
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 221 924 1.0E-48
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2795 3365 2.0E-48
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1439 2660 2.0E-48
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2785 3388 4.0E-48
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1519 2431 1.0E-47
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2796 3456 1.0E-47
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 331 1094 5.0E-47
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2830 3371 6.0E-47
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2767 3493 8.0E-47
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2843 3529 8.0E-47
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2873 3356 2.0E-46
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 320 916 2.0E-46
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2814 3356 2.0E-46
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 311 991 3.0E-46
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2142 2740 4.0E-46
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1869 2746 5.0E-46
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 293 726 1.0E-45
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1383 1808 1.0E-45
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2785 3479 1.0E-45
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2793 3277 2.0E-45
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2789 3277 2.0E-45
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 303 996 2.0E-45
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2789 3277 3.0E-45
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1442 2447 1.0E-44
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 304 906 2.0E-44
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 304 906 2.0E-44
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2873 3442 2.0E-44
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2786 3356 4.0E-44
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 295 902 6.0E-44
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2816 3356 9.0E-44
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2852 3356 2.0E-43
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1387 2425 6.0E-43
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1387 2425 8.0E-43
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1387 2425 2.0E-42
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2850 3467 2.0E-42
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 306 923 2.0E-42
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 240 923 1.0E-41
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 331 1089 2.0E-41
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2796 3356 2.0E-41
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2824 3464 2.0E-41
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 262 906 3.0E-41
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2860 3356 3.0E-41
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 310 907 4.0E-41
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2796 3482 4.0E-41
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2860 3356 1.0E-40
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 331 920 1.0E-40
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2806 3356 1.0E-40
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 262 906 2.0E-40
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 317 812 2.0E-40
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 306 907 2.0E-40
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2860 3356 2.0E-40
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2860 3356 2.0E-40
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 306 916 2.0E-40
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2819 3356 2.0E-40
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2819 3356 2.0E-40
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 306 906 3.0E-40
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 306 906 3.0E-40
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 306 906 3.0E-40
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2860 3356 3.0E-40
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 317 812 3.0E-40
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2850 3356 6.0E-40
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2796 3366 6.0E-40
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 306 907 8.0E-40
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 306 907 1.0E-39
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2860 3360 1.0E-39
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2850 3358 2.0E-39
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 317 812 2.0E-39
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2806 3356 4.0E-39
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 262 906 6.0E-39
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 306 906 1.0E-38
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 309 907 1.0E-38
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2771 3479 1.0E-38
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2771 3479 1.0E-38
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2872 3481 2.0E-38
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2856 3358 3.0E-38
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2850 3356 9.0E-38
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2850 3356 9.0E-38
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2846 3356 1.0E-37
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2848 3358 1.0E-37
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2837 3356 1.0E-37
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2850 3356 1.0E-37
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2856 3358 3.0E-37
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2852 3356 4.0E-37
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2852 3356 4.0E-37
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2845 3357 4.0E-37
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2850 3356 4.0E-37
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2850 3356 4.0E-37
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2850 3356 4.0E-37
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2850 3356 4.0E-37
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1832 2431 4.0E-37
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2845 3358 5.0E-37
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2850 3356 6.0E-37
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2852 3356 7.0E-37
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2852 3356 7.0E-37
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2852 3356 7.0E-37
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2852 3356 7.0E-37
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2852 3356 7.0E-37
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2852 3356 7.0E-37
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2852 3356 7.0E-37
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2852 3356 7.0E-37
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2852 3356 8.0E-37
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 243 810 1.0E-36
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 306 910 1.0E-36
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2912 3356 1.0E-36
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2845 3357 2.0E-36
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2844 3356 3.0E-36
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 299 902 4.0E-36
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2846 3356 4.0E-36
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2845 3357 4.0E-36
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 371 810 5.0E-36
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2846 3356 5.0E-36
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2846 3356 5.0E-36
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2845 3357 6.0E-36
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2845 3357 6.0E-36
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2854 3356 7.0E-36
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 618 1102 7.0E-36
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 313 811 9.0E-36
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 313 810 2.0E-35
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2854 3356 3.0E-35
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 301 906 3.0E-35
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2854 3356 4.0E-35
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 332 810 4.0E-35
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2850 3361 4.0E-35
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 370 810 5.0E-35
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 370 810 5.0E-35
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 370 810 5.0E-35
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 370 810 6.0E-35
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 370 810 6.0E-35
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 370 810 6.0E-35
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 370 810 6.0E-35
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 370 810 6.0E-35
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 370 810 6.0E-35
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 370 810 6.0E-35
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 370 810 6.0E-35
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 370 810 7.0E-35
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1817 2338 1.0E-34
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2763 3362 2.0E-34
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2763 3362 2.0E-34
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 370 810 2.0E-34
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 370 810 2.0E-34
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1841 2335 3.0E-34
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 370 810 3.0E-34
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1841 2335 3.0E-34
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1841 2335 3.0E-34
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1835 2335 3.0E-34
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1829 2409 4.0E-34
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1841 2335 5.0E-34
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2839 3436 7.0E-34
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1841 2335 7.0E-34
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1841 2335 7.0E-34
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1841 2335 7.0E-34
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1841 2335 7.0E-34
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1832 2410 9.0E-34
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 370 810 1.0E-33
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1841 2335 1.0E-33
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1841 2335 1.0E-33
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1841 2335 1.0E-33
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1841 2335 1.0E-33
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1841 2335 1.0E-33
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1841 2335 1.0E-33
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 370 810 1.0E-33
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 313 810 2.0E-33
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2837 3356 2.0E-33
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2837 3356 2.0E-33
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2837 3356 2.0E-33
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1841 2335 3.0E-33
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2843 3309 3.0E-33
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 330 811 3.0E-33
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 309 810 4.0E-33
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 309 810 2.0E-32
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2858 3358 2.0E-32
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1830 2434 4.0E-32
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1830 2434 4.0E-32
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2858 3358 5.0E-32
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 373 812 8.0E-32
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2858 3358 1.0E-31
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2858 3358 1.0E-31
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2858 3358 1.0E-31
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2858 3358 1.0E-31
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2858 3358 1.0E-31
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2858 3358 1.0E-31
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2872 3453 1.0E-31
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 370 812 1.0E-31
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 373 812 1.0E-31
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 373 812 1.0E-31
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2858 3358 1.0E-31
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1835 2337 2.0E-31
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 373 810 2.0E-31
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1665 2410 3.0E-31
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 373 810 3.0E-31
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 373 810 3.0E-31
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1832 2428 4.0E-31
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1435 2430 4.0E-31
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 373 810 4.0E-31
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 373 810 4.0E-31
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 373 810 4.0E-31
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 373 810 4.0E-31
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 370 812 5.0E-31
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2858 3358 6.0E-31
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2858 3358 6.0E-31
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2858 3358 6.0E-31
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2858 3358 6.0E-31
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2858 3358 6.0E-31
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2858 3358 6.0E-31
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1817 2436 7.0E-31
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 370 812 7.0E-31
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1665 2410 1.0E-30
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 370 812 2.0E-30
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1835 2338 3.0E-30
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 370 812 3.0E-30
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 321 810 4.0E-30
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 321 810 4.0E-30
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 321 810 4.0E-30
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 321 810 4.0E-30
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 321 810 4.0E-30
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 321 810 4.0E-30
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 309 810 8.0E-30
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 321 810 9.0E-30
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2860 3356 1.0E-29
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 313 810 1.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 313 810 1.0E-29
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 321 810 1.0E-29
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 321 810 2.0E-29
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 321 810 2.0E-29
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 321 810 2.0E-29
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 321 810 2.0E-29
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 321 810 2.0E-29
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 321 810 2.0E-29
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 321 810 2.0E-29
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2493 2765 2.0E-29
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1837 2247 2.0E-29
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 313 810 2.0E-29
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 313 810 2.0E-29
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 313 810 2.0E-29
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 313 810 2.0E-29
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 313 810 2.0E-29
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 313 810 2.0E-29
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 313 810 2.0E-29
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2872 3365 3.0E-29
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 293 916 3.0E-29
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 313 810 3.0E-29
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1833 2338 5.0E-29
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1833 2338 5.0E-29
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1833 2338 5.0E-29
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1833 2338 5.0E-29
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1833 2338 5.0E-29
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1833 2338 5.0E-29
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1835 2338 5.0E-29
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 316 810 5.0E-29
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 301 891 1.0E-28
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1508 2244 1.0E-28
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1835 2337 2.0E-28
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1833 2338 2.0E-28
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1831 2458 3.0E-28
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1833 2338 4.0E-28
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1833 2338 4.0E-28
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1833 2338 4.0E-28
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1833 2338 4.0E-28
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1833 2338 4.0E-28
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1833 2338 4.0E-28
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1833 2338 4.0E-28
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 276 754 5.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1833 2337 6.0E-28
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2848 3522 7.0E-28
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1833 2337 7.0E-28
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1854 2430 1.0E-27
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1833 2338 1.0E-27
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1832 2426 1.0E-27
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 237 723 2.0E-27
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1833 2336 2.0E-27
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1832 2335 2.0E-27
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1832 2335 2.0E-27
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1832 2335 2.0E-27
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1833 2336 4.0E-27
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 368 810 7.0E-27
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1524 2426 1.0E-26
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 316 810 1.0E-26
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1899 2335 2.0E-26
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1835 2335 2.0E-26
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1899 2335 4.0E-26
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1899 2335 5.0E-26
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2468 2740 5.0E-26
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1833 2336 6.0E-26
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1833 2336 1.0E-25
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1833 2336 3.0E-25
sp|O74419|YQ52_SCHPO Uncharacterized protein C162.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.02c PE=2 SV=1 3521 3839 1.0E-24
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1835 2335 2.0E-24
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2469 2762 2.0E-24
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1829 2335 2.0E-24
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2363 2740 3.0E-24
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1835 2335 3.0E-24
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1835 2335 3.0E-24
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1896 2337 3.0E-24
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2406 2766 6.0E-24
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1835 2335 1.0E-23
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1835 2335 1.0E-23
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1835 2335 1.0E-23
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1835 2335 1.0E-23
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1835 2335 1.0E-23
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1835 2335 2.0E-23
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1835 2335 3.0E-23
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1835 2335 3.0E-23
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1835 2335 3.0E-23
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1835 2335 3.0E-23
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1835 2335 3.0E-23
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1835 2335 3.0E-23
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1835 2335 3.0E-23
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1835 2335 3.0E-23
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1832 2335 3.0E-23
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1573 2409 5.0E-23
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1830 2244 6.0E-23
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2469 2743 1.0E-22
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 2984 3750 2.0E-22
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1837 2337 2.0E-22
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 835 1283 9.0E-22
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2464 2743 2.0E-21
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 835 1283 3.0E-21
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 835 1283 3.0E-21
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2751 3263 6.0E-21
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 358 921 1.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2222 2740 3.0E-20
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2299 2659 5.0E-20
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3159 3358 5.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2899 3356 7.0E-20
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 446 880 9.0E-20
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 3525 3863 3.0E-19
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 319 808 4.0E-19
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2469 2741 8.0E-19
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2344 2743 1.0E-18
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2852 3364 2.0E-18
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2916 3263 2.0E-18
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2847 3366 4.0E-18
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 454 926 2.0E-17
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1857 2337 3.0E-17
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 314 813 5.0E-17
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2850 3359 8.0E-17
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 374 723 1.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1397 1794 2.0E-16
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 2852 3358 4.0E-16
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2899 3358 9.0E-16
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2467 2746 9.0E-16
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1866 2351 1.0E-15
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2354 2744 1.0E-15
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2847 3356 2.0E-15
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 2854 3358 5.0E-15
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1833 2438 6.0E-15
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2992 3364 7.0E-15
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2914 3358 8.0E-15
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1976 2409 9.0E-15
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 2827 3370 1.0E-14
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2865 3357 2.0E-14
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 320 813 2.0E-14
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 2847 3358 2.0E-14
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 305 817 2.0E-14
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 2852 3358 2.0E-14
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 2854 3358 2.0E-14
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1390 1831 2.0E-14
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 2854 3358 3.0E-14
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2464 2741 3.0E-14
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1900 2244 4.0E-14
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 305 880 4.0E-14
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 449 812 4.0E-14
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 2990 3359 4.0E-14
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2469 2741 4.0E-14
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 455 812 5.0E-14
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 455 812 5.0E-14
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 449 813 7.0E-14
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2453 2740 8.0E-14
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2825 3357 8.0E-14
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 309 811 1.0E-13
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 1831 2337 1.0E-13
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 449 812 1.0E-13
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 449 812 1.0E-13
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 449 812 1.0E-13
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 449 812 1.0E-13
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 449 812 1.0E-13
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 449 812 1.0E-13
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 449 812 1.0E-13
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 449 812 1.0E-13
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 449 812 1.0E-13
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 449 812 1.0E-13
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1976 2431 2.0E-13
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 320 813 2.0E-13
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 449 812 2.0E-13
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 449 817 2.0E-13
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 2995 3358 3.0E-13
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 3505 3779 3.0E-13
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 289 811 3.0E-13
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 289 811 3.0E-13
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 307 818 4.0E-13
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 449 817 6.0E-13
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 320 813 6.0E-13
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2992 3354 7.0E-13
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 320 813 8.0E-13
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 311 811 1.0E-12
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 323 813 1.0E-12
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 1845 2337 1.0E-12
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 2995 3357 1.0E-12
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 2854 3357 1.0E-12
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 320 813 1.0E-12
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 455 723 1.0E-12
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 2852 3358 1.0E-12
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2825 3357 1.0E-12
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 2995 3358 2.0E-12
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 320 813 2.0E-12
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 320 813 2.0E-12
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 320 813 2.0E-12
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 449 812 2.0E-12
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 449 812 2.0E-12
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2986 3356 2.0E-12
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 2873 3358 2.0E-12
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 449 812 2.0E-12
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 449 812 2.0E-12
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 449 818 2.0E-12
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 2846 3357 2.0E-12
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 1845 2337 3.0E-12
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1981 2337 3.0E-12
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 449 812 3.0E-12
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 449 812 3.0E-12
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 449 812 3.0E-12
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 310 810 3.0E-12
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 320 813 4.0E-12
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2909 3357 4.0E-12
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 2981 3305 4.0E-12
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 419 813 4.0E-12
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 449 812 5.0E-12
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 320 813 5.0E-12
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 407 817 5.0E-12
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 2830 3361 5.0E-12
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 2830 3361 5.0E-12
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 289 811 6.0E-12
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2846 3358 6.0E-12
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2846 3358 6.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 320 810 6.0E-12
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 449 724 7.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2852 3356 9.0E-12
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 2995 3358 1.0E-11
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 332 813 1.0E-11
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 2825 3357 1.0E-11
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 309 811 1.0E-11
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 320 813 1.0E-11
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 2995 3278 1.0E-11
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 332 806 1.0E-11
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 332 806 1.0E-11
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 332 806 1.0E-11
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 332 806 1.0E-11
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 2995 3264 1.0E-11
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 2995 3358 2.0E-11
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 3529 3769 2.0E-11
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 2995 3264 2.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2560 2748 2.0E-11
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 2830 3361 3.0E-11
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 332 806 3.0E-11
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 332 806 3.0E-11
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 428 842 3.0E-11
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 332 806 3.0E-11
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 332 806 3.0E-11
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2351 2778 3.0E-11
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 2995 3264 3.0E-11
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 2995 3264 3.0E-11
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 2995 3278 3.0E-11
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 355 738 3.0E-11
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 2995 3278 3.0E-11
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 320 813 4.0E-11
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 2873 3358 4.0E-11
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1523 1728 5.0E-11
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 2995 3302 5.0E-11
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 2995 3302 5.0E-11
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 2995 3302 5.0E-11
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 428 816 6.0E-11
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 313 811 6.0E-11
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 2995 3302 6.0E-11
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 2995 3357 7.0E-11
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 2871 3357 7.0E-11
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 313 811 7.0E-11
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 2995 3302 7.0E-11
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 2995 3302 7.0E-11
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 2995 3300 7.0E-11
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 2873 3357 8.0E-11
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 324 810 9.0E-11
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 1981 2337 1.0E-10
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 2995 3306 1.0E-10
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 2995 3306 1.0E-10
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 2995 3306 1.0E-10
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 2995 3306 1.0E-10
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 2995 3278 1.0E-10
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 1961 2337 1.0E-10
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 2995 3302 1.0E-10
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 2995 3302 1.0E-10
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 2995 3302 2.0E-10
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 449 1097 2.0E-10
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 2995 3306 2.0E-10
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 2995 3306 2.0E-10
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 2995 3306 2.0E-10
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 2995 3306 2.0E-10
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2872 3378 2.0E-10
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 315 811 2.0E-10
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2995 3295 2.0E-10
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1400 1762 3.0E-10
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2857 3358 3.0E-10
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 315 811 3.0E-10
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 2850 3358 3.0E-10
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 2850 3358 3.0E-10
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 2995 3357 3.0E-10
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 3528 3822 3.0E-10
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 455 811 3.0E-10
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1367 1708 3.0E-10
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2366 2643 3.0E-10
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1963 2336 3.0E-10
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 1858 2337 3.0E-10
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 1981 2337 3.0E-10
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 315 811 4.0E-10
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 315 811 4.0E-10
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 1970 2337 4.0E-10
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2839 3361 4.0E-10
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1851 2244 4.0E-10
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 315 811 4.0E-10
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1398 1749 5.0E-10
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 2871 3357 5.0E-10
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 2871 3357 5.0E-10
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 315 811 5.0E-10
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 1841 2338 5.0E-10
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 2871 3357 5.0E-10
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 2995 3357 5.0E-10
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 2871 3357 5.0E-10
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2857 3358 6.0E-10
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 2871 3357 6.0E-10
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 2919 3358 6.0E-10
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 2871 3357 6.0E-10
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 2871 3357 7.0E-10
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 2982 3358 7.0E-10
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 2871 3357 7.0E-10
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 315 811 9.0E-10
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 2873 3357 9.0E-10
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 2873 3357 9.0E-10
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 2871 3305 9.0E-10
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 2873 3357 9.0E-10
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1977 2336 1.0E-09
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 2873 3357 1.0E-09
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 2984 3374 1.0E-09
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 2871 3358 1.0E-09
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 2873 3357 1.0E-09
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 315 811 1.0E-09
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2972 3357 1.0E-09
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 2872 3357 1.0E-09
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 2871 3357 1.0E-09
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 2871 3357 1.0E-09
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 2873 3357 1.0E-09
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 451 811 1.0E-09
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 451 811 1.0E-09
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 451 811 1.0E-09
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 2830 3361 1.0E-09
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 2830 3361 1.0E-09
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 3409 3791 1.0E-09
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 2871 3357 1.0E-09
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 1851 2336 1.0E-09
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 315 811 1.0E-09
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 428 812 1.0E-09
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1981 2336 1.0E-09
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 2873 3357 2.0E-09
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 2873 3357 2.0E-09
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 2873 3357 2.0E-09
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 1846 2336 2.0E-09
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 2873 3357 2.0E-09
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 315 811 2.0E-09
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2852 3360 2.0E-09
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 2845 3358 2.0E-09
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 315 811 2.0E-09
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2995 3362 3.0E-09
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 2873 3357 3.0E-09
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 315 811 3.0E-09
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 2873 3357 3.0E-09
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 2846 3358 3.0E-09
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 2995 3358 3.0E-09
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 2873 3357 3.0E-09
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 2973 3357 3.0E-09
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 2852 3364 3.0E-09
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 2995 3356 3.0E-09
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 315 811 4.0E-09
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 315 811 4.0E-09
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 315 811 4.0E-09
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 315 811 4.0E-09
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 2872 3357 4.0E-09
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 2871 3305 4.0E-09
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 315 811 4.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1979 2341 4.0E-09
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 307 812 5.0E-09
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 2857 3356 5.0E-09
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 2857 3356 5.0E-09
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 2857 3356 5.0E-09
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 2857 3356 5.0E-09
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 2857 3356 5.0E-09
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 315 811 5.0E-09
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 320 810 6.0E-09
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 2873 3357 7.0E-09
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 2857 3356 7.0E-09
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1946 2333 8.0E-09
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 2857 3356 8.0E-09
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 2857 3356 8.0E-09
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 1841 2247 9.0E-09
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 1841 2247 9.0E-09
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 315 811 9.0E-09
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 2873 3357 9.0E-09
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2846 3357 1.0E-08
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1382 1722 1.0E-08
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 1980 2256 1.0E-08
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 2873 3357 1.0E-08
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 455 814 1.0E-08
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 2873 3357 1.0E-08
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 2873 3357 1.0E-08
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 2873 3357 1.0E-08
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 2873 3357 1.0E-08
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 2873 3357 1.0E-08
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 2873 3357 1.0E-08
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 2987 3358 1.0E-08
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 1975 2337 1.0E-08
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2995 3310 1.0E-08
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 1981 2336 2.0E-08
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 315 811 2.0E-08
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 315 811 2.0E-08
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 315 811 2.0E-08
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 2873 3357 2.0E-08
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 2973 3367 2.0E-08
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2866 3367 2.0E-08
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 2919 3377 2.0E-08
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 3510 3751 2.0E-08
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 315 811 3.0E-08
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 2835 3322 3.0E-08
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 2835 3322 3.0E-08
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 315 811 3.0E-08
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 2873 3264 3.0E-08
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 2857 3356 3.0E-08
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 2857 3356 3.0E-08
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 2857 3356 3.0E-08
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 2857 3356 3.0E-08
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 2857 3356 3.0E-08
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 2857 3356 3.0E-08
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 2990 3358 4.0E-08
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 1974 2336 4.0E-08
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 1841 2244 4.0E-08
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 2973 3357 4.0E-08
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 2915 3358 4.0E-08
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 2847 3358 5.0E-08
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 1951 2337 5.0E-08
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 1951 2337 5.0E-08
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 315 811 5.0E-08
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 2993 3358 5.0E-08
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 2966 3358 5.0E-08
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 2834 3356 5.0E-08
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 2995 3357 5.0E-08
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 1959 2337 6.0E-08
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 1858 2336 6.0E-08
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 450 808 6.0E-08
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 1841 2332 7.0E-08
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 1841 2332 7.0E-08
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 2995 3358 7.0E-08
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 3528 3750 7.0E-08
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 3529 3751 8.0E-08
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 332 811 8.0E-08
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 324 747 9.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 457 812 9.0E-08
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2842 3357 1.0E-07
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2846 3358 1.0E-07
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 2873 3357 1.0E-07
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 2161 2337 1.0E-07
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 2857 3356 1.0E-07
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 1846 2336 1.0E-07
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 2851 3366 1.0E-07
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 764 1094 2.0E-07
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2995 3356 2.0E-07
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2866 3367 2.0E-07
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 1974 2337 2.0E-07
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 1980 2256 2.0E-07
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 315 727 2.0E-07
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 1975 2337 2.0E-07
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 455 811 2.0E-07
sp|P95141|FAA29_MYCTU Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD29 PE=1 SV=1 2912 3350 2.0E-07
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 431 811 2.0E-07
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2111 2335 2.0E-07
sp|Q7TXK5|FAA29_MYCBO Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD29 PE=3 SV=1 2912 3350 2.0E-07
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 2995 3358 2.0E-07
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 455 818 2.0E-07
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2997 3357 2.0E-07
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 1980 2256 2.0E-07
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 1980 2256 2.0E-07
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 1974 2337 3.0E-07
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 321 811 3.0E-07
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 321 811 3.0E-07
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 1980 2256 3.0E-07
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 1841 2337 3.0E-07
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2995 3358 3.0E-07
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 2867 3358 3.0E-07
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 1980 2256 3.0E-07
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 1980 2256 4.0E-07
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 1980 2256 4.0E-07
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 1974 2338 4.0E-07
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 1980 2256 4.0E-07
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 1980 2256 4.0E-07
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 1980 2256 4.0E-07
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 299 814 4.0E-07
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 1980 2256 5.0E-07
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 2995 3357 5.0E-07
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 2919 3358 5.0E-07
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2997 3358 6.0E-07
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 321 811 6.0E-07
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 2847 3358 6.0E-07
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 2847 3358 6.0E-07
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 2847 3358 6.0E-07
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 3177 3369 6.0E-07
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 2873 3358 6.0E-07
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 1980 2256 8.0E-07
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 2830 3357 8.0E-07
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 2990 3356 9.0E-07
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2846 3358 1.0E-06
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 1980 2245 1.0E-06
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2846 3358 1.0E-06
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 1980 2256 1.0E-06
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2352 2429 1.0E-06
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 1981 2336 1.0E-06
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 2995 3356 1.0E-06
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 2973 3367 1.0E-06
sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 267 474 1.0E-06
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 2870 3358 1.0E-06
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1856 2343 2.0E-06
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 428 811 2.0E-06
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2846 3358 2.0E-06
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2846 3358 2.0E-06
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2846 3358 2.0E-06
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 2932 3356 2.0E-06
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 1854 2337 2.0E-06
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2297 2551 3.0E-06
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2846 3358 3.0E-06
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 449 812 3.0E-06
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 1840 2333 3.0E-06
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 2081 2335 3.0E-06
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 320 804 3.0E-06
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2997 3367 4.0E-06
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1394 1711 4.0E-06
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 2981 3358 4.0E-06
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 324 813 4.0E-06
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 2900 3357 4.0E-06
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 1857 2192 5.0E-06
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 2845 3357 5.0E-06
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 454 812 5.0E-06
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2846 3358 6.0E-06
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2846 3358 6.0E-06
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2846 3358 6.0E-06
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 1982 2338 8.0E-06
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 1976 2250 1.0E-05
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 299 737 1.0E-05
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 299 737 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0003824 catalytic activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0048037 cofactor binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6340
MALTHGNNGFGRLETADPEAPHAVITTTVPRTHDTGANVDTAVNGFDMAATANILKAAMLVRRNSSQESITDSSP
GAMSDYDSLVPTPPLSPDKPSASRLVLNHRIKHVTTLGTGKTKTNLLVAAWAIVASQLQNSSHVVLQVAMDPRAH
VIASIQVELHGDTSVTALVQTVENQMAAVASLPLANGRPKDIEPSSGLNTLLIIGGSETVDMQNGGIGDGQQEQS
NSYGLVLRAHLGDEMHVSACFDAQVLEPWTANSLLRRLSHVMHQFSQADAQKPLSQVEMASQDLQQIWRWNAVVP
SAVERCFHDVFQDSVRQHADALAIDAWDGQLSYTKLHQLSWALADKLVELGVGPGVFVPLCFEKSVWTSVAVLAV
SKAGGAFVLLDPGQPEQRLDTIVEQVQGRLILASSSMQALAARLCQHVLALDWRFFKDLTQQKPSCPKTSLVLPS
SILYVVFTSGSTGKPKGVLISHANAASALSYQVQPMGLTADTRFFDFSSYSFDVSINSLFTVLAAGGCLCVPSET
DRRDNLSKSINDLGANWLDLTPSIVRNLWPQELPKVRCITLGGEALRATDVERFWGKVRIFNAYGPSECTPTSTI
NYDASSLDGLTRIGKGLGVVTWVASPDDHNTLVPPGCIGELLLEGPLVGGGYLNDSARTAAAFIEDPTWLTLGVP
GVQPGRRARLYKTGDLVRYHEDGSLIYIGRKDAQVKIRGQRVELGDVEHHLAMCLPWAREVAAEVLAFEGRQTLA
AFVVKPDSSNKQTQCTSISLSADEERLLASRLPVYMVPTIYLGLEKMPVNSAGKTDRKQLRALGVEALNIQALDV
DDNVCCKSNANPGQDAAELALRRIWARVLNVAASRIGSNVSFFRLGGDSITAMQVSAAARASGMDISTADVLRHK
TIAVLAATAKHHVASSATQHQGHEHDGRPFQSSPMQQLYLSFEPDPTRCYDQNFLLRLRRPLALDTLQRALEAIV
SRHAMLRARFTRADNGQWTQRIAARQDALSCFSVSQAPPDSNLAHTIRTCRQRLDIINGPLLVAALVFAGQGGDK
PAQSLFIAIHHLVIDLVSWRVLFQELEELITKGQILLPPPSVSFPAWSTMQAAYANEKLSLDTTQDAPPPLLSYW
GIDAASNVDGATASLTFVVDEQSSAALLGPANQALNTKPVELLVASLIRSFAVTFPDRPVPAVFNEGHGREPWED
DIDVSRTVGWFTTMYPIHVPAVKLLDALRRTKDQARGLAKNGWSYFTSRFASANRAATSACQFPVEVVLNFAGSY
QQLERTDSIFELVPLPNDCRPASAAGLRRFELFEVHVQVNRGRLAVSLLYPKYARHQERIAAWMDCYQATLAQAA
SLLAHKPLQWTLSDFPLAFSSYDSIHEFQIRLLPELGITGPDQVEDVFPCTGIQEGMLLAQAKDSANYRSALSFD
IRTTKPGQVISFDRIEGAWRAVVRRHSLLRAILVDTVPGTGRTMHVVLADPMPDMTFMTTASKNKSSQAVVGYQK
HQLQHHMTVIRVDETRVQVQLEINHAIVDGYSDGIILHDFWQAYSGSLSPQGPLFRDYVAHIEQQQSQTSGRDFW
ANHLDSVQPCIFPVSKAGKEQMKEFNVAVEGLDTAKIHAFCARHELTTASVVQLAWALVLRQYTASTSPCFGNMT
SSRGVAIKDIGDMLGPVIGLTPRRINLDTELSVMETLRQVHAYHLDSLPYQTNSLLDIQRHIKIGQHRLFNTIMS
FQKERSGLLPSADGHILDEGAIVDPVEYEVAVNIEDSDEELSIQLAFHAGVLGGHEAERVSRTLGAAISLIVSDY
GAKMSSASPLHDNDLEQLWSANSVVPAAAEQCIHDVIGAVAQSQPDAQAVCAWDGDLTYEQLMHFASVLARRLIA
MGVGPGTTVPLCFEKSKWTPVATLAVAQTGAAFVSLDPALPEQRLTSIVQQVQAGLLLSSPCHQQLGMRLCPQVL
AISHGFFAETSHDTAIPLPSVDLDSLIYFVFTSGTTGVPKGVMTMHRASASAVKYQVQGLKYTTKTRVYDFSTYS
FDAAISNIFTVLAAGGCLCVPADQDRISNLEMSLNSLKATAVLLTPSVAQLLCPDRLPYLEAVILMGEKVRVKDI
EPWWGRGFTLYGPSECTPVSLINPNPTSPEQAVCLGQGFGSVPWIVDAKDHNRLLPPGCVGELLIEGPIVGAGYL
GNAEKTAAAFIEDPTWMVRGAPGRPGRHGRLYKTGDLVCLDDEGNISFLERKDMQIKIRGQRVELAEIEHWVRIC
MPETPHVIVEVVEPEGKSSSAFVALFLDMDTETVALAPDSVKVLPVPAKVQAKLAEHLPSYMVSTVMFSLQIPTT
VSGKTDRRRLREIGASFSLDQLAEMRTAGIESKQKPLSKMEQLLQDIWARVLNMKASVIGVQDSFFRLGGDSIAA
IRVVGEARKEGFKLSVSDILRHQTLQDIVSHSCKDMEDVQRRFAPFCLLGDGFDAADIARHYHLDPDAIVDAYPC
TPLQEGLMTLTSKIDGTYMTQNVLELADNVDVDKLCAAWEHVTCALPLLRTRIVQNSDLSLQQIVLDQKICWTRA
TGLQSHLDADGQQSMPLGEPLARYALVSNETGTVKWLVWTVHHALYDGWSMPLVIDAVYQAYEGKRLDDEFPPFQ
AFIEYIKGQDEQALSSYWQDALADCQSIPFPALPPSLEQQLAPTSHVEHSLTLPTSKTPNVTASTLIRAAWAFVV
GCMTDSDDVVFGATVSGRSAPVAGLDRMAAPTIATLPLRLRPEESIVGAGPLGSWLDSSQPQWIDTYALTLELRL
GAKRGAALAIFDSRVISPWLVQTLLQRLDFVVQQFSNANPSQTLSSVGLMTPQDLESIWQWNATVPLPATQSVAQ
MIAERVQAQPDAPAVCAWDGELTYSQLDTLATRLANLLVDHGVAAQVPLVPLCFEKSMWTTVAILGVVKAGAAFI
LLDPALPEQRLKSIVQQVRANLILTCPSAQALSSRLANQTITLSSSLFADLPDGGRQHVPALSLSSLLYILFTSG
STGTPKGVKITHLNAASALVHQTHRIGFTPESRVFDFASYSFDVSISNVFSTLTSGACLCVPKDQDRQTNLEQSI
ASLRANVLDITPTLAHILSPANIPLVKTIILSGEAFRAADVEKWLRAEVRLVNAYGPSECTPTGTLNCSARTPQA
VVSIGKGVGVVTWIVNPNSHDQLLPPGSVGELLLEGPLVGNGYLDDPKRTAAVFIDDPSWLLQGAPGQPGRHGRL
YKTGDLVRYNQDGSLVFIGRKDTQTKIRGQRVELEEIEHHVCRCVPSVRQAVAEVVTPDDQGSPMVVVFVEVDDE
ARTEERERTEPSIMSITPQVERQLADHLTSYMMPAFFLSMAELPVTPTGKTDHKKLRQTGRDFLAAGAKSPSLQL
LVGDGETITKTEQPAYALAQSVFSMLPSWRRQSLSSQDASSFENVLLQPCGLDSINMMSLIRHVLREFGVKLSLE
LLLDRTTSIRTLAKSVLDLQDAQTQTSQGMLPTHYSPSVDIMAQVEKHDATVAAVQQQVASAEAYTNGNDTNSQK
PLTVLLTGANGFIGSQILRQLLESKTIGQVVAVVRGETRDAARKRAISAAKTALWWTDEHADKLQVWPGDLSLPQ
LGLDATHWARFADQEWFDIVIHSGAEVHWGKNYASLEATNVSSTVELLRTVVAVPGMKFVYVSGGRDGGAEDEDE
EQVAQELGAPGAIGYSQTKFVAEAVVKRAAKRCAMSPSRLAVVTPGLVVGTPTEGVPNADDYMWRLAASCIRVGM
YNADEADAWLALSDVAALAAIIVDSALHPDAVPEAKRYVRDGMKWRDFWAILSGLGYQLQAKPVTQWLAAVRKDI
DAVGETHPLWPLKHLVEEESLMQNNETSDSSSEGETPHRLTVAVEKSAQFLCKCGFFEPVPLADCQGAPQREVVS
CKPFTRSKK*
Coding >OphauB2|6340
ATGGCCTTGACCCATGGTAACAATGGCTTTGGCCGTCTCGAGACTGCAGATCCTGAGGCTCCACACGCTGTCATC
ACCACCACGGTTCCTAGGACTCATGACACGGGAGCCAATGTCGACACCGCTGTCAATGGCTTCGACATGGCTGCA
ACTGCCAATATACTTAAGGCAGCCATGCTCGTGAGGCGCAATTCCTCCCAGGAGAGCATCACCGACTCTTCTCCA
GGCGCCATGTCAGACTACGATTCACTTGTCCCTACGCCACCCTTGTCTCCAGACAAACCATCGGCCTCTAGACTC
GTCCTCAACCACCGCATCAAACATGTCACAACGCTCGGGACTGGCAAGACCAAGACTAATCTGCTCGTCGCAGCT
TGGGCCATCGTTGCCAGTCAATTGCAGAATTCCAGCCATGTTGTACTTCAAGTTGCCATGGATCCAAGGGCACAT
GTGATAGCCTCGATACAAGTCGAGCTACACGGCGACACCAGCGTCACAGCCCTCGTGCAAACAGTGGAGAACCAG
ATGGCTGCCGTTGCTTCGTTGCCACTAGCCAACGGGCGGCCAAAAGATATTGAGCCAAGCAGCGGGCTTAACACG
CTGCTTATAATCGGGGGGAGCGAGACAGTTGACATGCAAAATGGCGGCATCGGGGACGGCCAGCAAGAGCAGTCC
AATTCGTACGGGCTGGTGCTCAGGGCCCATCTTGGAGACGAGATGCATGTGTCTGCTTGCTTTGATGCGCAGGTG
CTGGAGCCATGGACGGCAAACAGCCTGCTTCGACGGCTGAGCCATGTGATGCACCAGTTTAGTCAGGCAGATGCT
CAAAAGCCGCTAAGCCAGGTTGAAATGGCAAGCCAAGACTTGCAGCAGATTTGGAGGTGGAACGCTGTCGTGCCG
AGTGCAGTAGAGCGCTGTTTCCATGATGTCTTTCAAGACAGCGTGCGCCAACATGCCGACGCCTTGGCCATTGAT
GCCTGGGACGGCCAGCTTAGCTATACCAAGTTGCATCAGCTCTCCTGGGCTCTGGCAGACAAGTTGGTTGAGCTC
GGCGTCGGCCCAGGTGTCTTTGTGCCACTGTGCTTTGAAAAGTCTGTGTGGACATCTGTTGCCGTGCTCGCCGTC
TCCAAGGCGGGCGGCGCCTTTGTCCTGCTTGACCCCGGGCAACCGGAGCAGCGCCTTGACACCATTGTCGAGCAG
GTCCAGGGCCGATTGATACTGGCATCGTCGTCGATGCAAGCCCTGGCTGCCCGGCTGTGTCAACATGTATTGGCC
CTAGACTGGCGCTTCTTCAAAGACTTGACGCAGCAAAAACCAAGCTGCCCAAAGACTAGCTTGGTCCTGCCGTCA
TCTATTCTCTATGTCGTCTTCACATCCGGCAGCACGGGGAAGCCCAAGGGTGTCCTGATAAGCCACGCCAATGCT
GCGTCAGCTCTCTCCTACCAGGTGCAGCCAATGGGACTGACGGCCGACACACGCTTCTTTGACTTTTCATCATAT
AGCTTCGATGTGTCCATCAACAGTCTCTTTACCGTGCTGGCAGCGGGGGGCTGTCTCTGTGTTCCTAGTGAGACA
GACCGAAGAGATAACCTGTCCAAGAGCATTAATGACTTGGGCGCCAATTGGCTCGACCTGACGCCGTCCATTGTG
CGCAATCTCTGGCCTCAAGAACTGCCCAAGGTGCGCTGCATAACGCTTGGGGGTGAGGCTCTGCGTGCCACCGAT
GTGGAGCGTTTCTGGGGCAAGGTGCGAATCTTCAATGCCTACGGACCAAGTGAATGCACACCCACCAGTACCATC
AACTACGATGCCTCTAGCCTAGATGGCCTGACCCGCATTGGAAAGGGGCTGGGAGTGGTGACGTGGGTGGCGAGC
CCTGATGACCACAATACCTTGGTGCCGCCTGGCTGCATTGGCGAATTGCTCCTCGAAGGACCCCTCGTCGGCGGC
GGCTACCTCAACGACTCGGCCCGGACAGCCGCTGCCTTCATCGAGGACCCAACGTGGCTGACCTTGGGTGTGCCA
GGCGTCCAGCCAGGTCGTCGTGCCAGGCTGTACAAAACGGGTGATTTGGTCCGGTATCACGAGGACGGCAGCTTG
ATATACATTGGTAGAAAAGATGCCCAGGTCAAGATTCGCGGCCAGCGCGTCGAACTGGGAGATGTTGAGCATCAT
CTGGCCATGTGCTTGCCCTGGGCTCGAGAGGTGGCGGCCGAGGTGCTGGCATTCGAGGGCAGGCAGACGCTGGCC
GCCTTTGTTGTCAAGCCAGACAGCAGCAACAAGCAGACACAATGTACATCCATTTCTCTCTCGGCCGACGAGGAA
AGGCTGCTCGCCAGCCGTCTGCCCGTGTACATGGTGCCCACCATCTACCTTGGCCTTGAAAAGATGCCCGTCAAC
AGCGCGGGCAAGACAGACCGGAAGCAACTGCGAGCCCTAGGAGTCGAGGCGCTCAATATTCAGGCCCTTGATGTC
GACGATAATGTTTGTTGTAAAAGTAATGCCAATCCTGGTCAAGACGCTGCCGAGCTGGCTCTCCGGCGCATCTGG
GCCCGCGTCCTTAATGTCGCCGCCTCGCGCATTGGCTCCAACGTCAGCTTCTTCCGCCTTGGAGGTGATTCCATC
ACCGCCATGCAAGTGTCGGCCGCGGCACGGGCATCGGGCATGGACATTTCCACAGCCGACGTTTTGCGCCACAAG
ACCATTGCCGTCCTTGCCGCCACGGCCAAGCACCATGTTGCCTCGTCCGCCACGCAGCACCAGGGCCACGAGCAT
GATGGCCGCCCATTTCAATCCAGTCCCATGCAGCAGCTCTATCTCTCCTTTGAGCCTGATCCCACTCGCTGCTAC
GACCAAAACTTCCTGCTCAGGCTGCGCAGACCCCTGGCCCTTGACACACTGCAGCGAGCGCTTGAGGCAATTGTC
TCTCGACACGCCATGCTGCGCGCCCGTTTCACGCGAGCCGACAATGGTCAATGGACGCAGCGCATTGCAGCCCGC
CAAGACGCCTTGTCGTGCTTTTCTGTTTCCCAGGCTCCTCCAGACTCCAATCTTGCCCACACAATTCGCACCTGT
CGCCAACGCCTCGACATCATCAATGGCCCGCTGCTCGTGGCCGCCCTTGTCTTTGCAGGTCAAGGAGGCGACAAG
CCGGCCCAGAGCCTCTTCATTGCTATTCATCATCTTGTCATCGATCTCGTGTCGTGGCGTGTCTTGTTTCAAGAG
CTCGAGGAGCTCATCACCAAGGGACAAATCTTGTTGCCGCCGCCGTCTGTGAGCTTCCCTGCATGGAGCACAATG
CAGGCAGCATATGCCAACGAGAAGCTCAGTCTCGACACCACTCAGGACGCGCCGCCTCCGCTCTTGTCGTACTGG
GGTATCGATGCAGCCAGCAACGTCGACGGCGCTACAGCGTCCCTGACCTTTGTCGTCGACGAGCAGTCAAGTGCT
GCCTTGCTTGGTCCTGCCAACCAGGCCTTGAATACCAAGCCAGTCGAGCTGCTCGTGGCATCCCTGATACGTTCC
TTTGCCGTCACATTTCCAGACCGTCCTGTTCCCGCCGTATTCAACGAGGGCCACGGTCGCGAGCCCTGGGAAGAC
GACATTGACGTCTCGCGCACTGTGGGCTGGTTCACCACCATGTATCCCATTCATGTGCCTGCCGTCAAATTACTG
GATGCACTGCGACGTACAAAGGACCAAGCTAGAGGGCTGGCAAAAAATGGTTGGAGCTACTTCACATCGCGTTTT
GCCAGTGCAAATCGTGCAGCAACCAGTGCTTGCCAGTTCCCTGTAGAAGTCGTCCTCAACTTTGCCGGCTCCTAC
CAGCAGTTGGAGCGAACCGACTCCATCTTTGAGTTGGTCCCCTTGCCAAACGATTGCCGTCCAGCCTCGGCGGCT
GGTTTGCGTCGTTTCGAGCTCTTCGAGGTGCACGTTCAAGTCAACCGAGGACGGTTGGCTGTCTCGCTGCTCTAT
CCCAAGTACGCACGTCACCAGGAGCGCATTGCAGCATGGATGGACTGCTACCAGGCCACTCTGGCACAGGCTGCC
AGCCTGCTGGCGCACAAGCCGCTTCAGTGGACACTGTCCGACTTTCCACTGGCCTTTTCCTCCTATGACAGTATC
CACGAATTCCAGATCCGGCTTCTGCCTGAGCTGGGTATCACTGGCCCAGACCAAGTAGAGGACGTGTTTCCTTGC
ACCGGCATCCAAGAAGGCATGCTGCTCGCTCAAGCCAAAGACTCGGCAAACTATCGATCAGCGCTCAGCTTCGAT
ATTCGAACCACCAAGCCGGGGCAGGTAATCAGCTTTGATAGGATTGAAGGCGCCTGGAGAGCCGTTGTGCGTCGC
CACTCGCTGCTACGCGCAATTCTCGTCGACACGGTGCCGGGGACTGGCAGAACCATGCACGTCGTTTTGGCCGAT
CCGATGCCCGACATGACATTTATGACGACGGCCAGCAAAAACAAAAGCAGCCAGGCAGTCGTGGGCTACCAGAAG
CATCAGTTGCAGCATCACATGACAGTGATTCGGGTCGATGAGACGCGAGTCCAAGTCCAGCTCGAGATTAACCAC
GCCATTGTCGACGGCTACTCGGATGGCATCATTTTGCACGACTTTTGGCAGGCGTATAGCGGCAGTCTGAGTCCC
CAAGGTCCTCTTTTCCGAGACTATGTTGCCCATATCGAGCAGCAGCAGTCACAGACCTCTGGCAGAGACTTTTGG
GCCAACCATCTCGATAGTGTGCAACCGTGTATTTTCCCCGTCTCCAAGGCTGGCAAAGAGCAAATGAAGGAGTTC
AACGTAGCTGTTGAGGGGCTGGATACAGCCAAAATTCATGCCTTTTGCGCCAGACATGAGCTGACAACGGCTTCC
GTCGTCCAACTTGCTTGGGCATTGGTGCTTCGCCAGTACACAGCATCAACATCGCCATGCTTTGGAAACATGACG
TCCAGCCGGGGCGTGGCCATCAAAGACATTGGAGATATGCTGGGGCCAGTCATTGGCTTGACGCCACGCCGCATC
AACCTCGACACGGAGCTCTCCGTCATGGAGACGTTGCGTCAAGTGCATGCCTATCACCTCGACAGCTTGCCGTAC
CAGACGAATTCGCTCCTCGACATTCAGCGCCACATAAAAATAGGACAGCACCGACTCTTCAACACCATTATGAGC
TTTCAAAAGGAGCGCTCTGGGCTCCTGCCATCAGCAGACGGACATATCCTTGATGAAGGGGCCATTGTGGATCCT
GTCGAGTACGAGGTTGCTGTCAATATCGAGGATAGCGACGAAGAATTGTCCATCCAGCTAGCCTTTCATGCTGGC
GTGCTGGGCGGCCATGAGGCAGAGCGAGTGTCACGTACTCTGGGAGCCGCCATCTCCTTGATTGTCAGCGACTAT
GGCGCCAAAATGAGCAGCGCCAGTCCTTTACACGACAACGACTTGGAGCAGCTCTGGTCTGCCAACAGTGTCGTG
CCAGCAGCGGCTGAGCAGTGTATCCACGACGTGATTGGGGCGGTAGCCCAGAGCCAGCCCGATGCACAGGCAGTG
TGTGCTTGGGACGGGGACCTGACGTACGAGCAACTGATGCATTTTGCCTCAGTGCTAGCTAGACGTCTGATTGCC
ATGGGCGTGGGACCGGGCACCACTGTACCGCTATGCTTTGAGAAATCAAAATGGACGCCGGTTGCCACGCTTGCA
GTCGCCCAGACCGGAGCCGCCTTTGTTTCCCTTGACCCGGCACTTCCAGAGCAACGGCTTACATCCATTGTCCAG
CAGGTGCAAGCAGGCCTGTTGCTCTCGTCTCCTTGCCACCAGCAACTGGGTATGCGACTTTGTCCACAAGTACTG
GCCATCAGCCACGGCTTCTTTGCTGAGACGAGCCATGACACGGCTATTCCGCTACCAAGCGTCGATTTGGACTCT
TTGATCTATTTCGTCTTCACCTCTGGAACCACTGGAGTGCCCAAGGGCGTCATGACGATGCATAGAGCATCTGCA
TCCGCGGTCAAGTATCAAGTGCAAGGCCTGAAATACACGACCAAGACGAGGGTCTATGACTTCTCCACGTATAGT
TTCGACGCCGCCATCAGCAACATCTTTACCGTCTTGGCTGCAGGAGGCTGCTTGTGTGTTCCGGCAGACCAGGAC
AGAATATCCAATCTCGAAATGAGCCTCAACTCTTTGAAAGCCACGGCTGTACTTCTCACGCCTTCCGTGGCCCAG
CTTCTATGTCCAGATCGGCTGCCTTACCTCGAAGCTGTGATCCTCATGGGAGAAAAGGTTCGCGTCAAGGATATT
GAGCCATGGTGGGGAAGAGGCTTTACCCTTTATGGGCCGAGCGAGTGTACACCCGTAAGTTTAATCAACCCCAAT
CCAACAAGTCCTGAGCAGGCCGTTTGTCTGGGTCAAGGCTTTGGTTCTGTGCCATGGATTGTGGACGCAAAAGAT
CACAACCGCTTGCTGCCTCCGGGCTGCGTTGGCGAGCTTTTGATTGAAGGGCCAATAGTGGGTGCCGGCTATCTT
GGCAATGCAGAGAAAACAGCAGCTGCCTTTATCGAAGACCCGACTTGGATGGTCCGAGGGGCTCCCGGTAGGCCA
GGCCGTCACGGTCGCCTCTATAAGACGGGAGATCTGGTTTGCCTCGATGATGAGGGGAATATCTCGTTTCTTGAG
CGCAAGGACATGCAAATAAAGATCCGAGGCCAGCGGGTGGAGCTGGCAGAGATTGAACACTGGGTCCGCATCTGC
ATGCCCGAGACTCCCCATGTCATAGTTGAAGTGGTTGAGCCAGAAGGGAAAAGCTCAAGTGCGTTTGTCGCTCTA
TTCCTTGACATGGACACGGAAACGGTTGCCTTGGCGCCTGATTCTGTCAAGGTGCTGCCTGTGCCTGCAAAAGTG
CAGGCCAAGCTGGCCGAGCACCTGCCAAGCTACATGGTGTCGACAGTCATGTTTTCCCTGCAGATACCGACGACT
GTGAGTGGGAAAACGGATAGAAGACGGTTACGCGAGATTGGAGCTTCATTCTCGCTTGATCAGCTGGCTGAAATG
CGCACTGCGGGCATAGAAAGCAAGCAGAAGCCCCTGTCCAAGATGGAACAGCTCCTACAAGACATCTGGGCCCGC
GTGCTCAATATGAAAGCCTCGGTAATTGGAGTCCAAGATAGCTTCTTCCGCCTCGGCGGTGACTCGATTGCTGCA
ATCAGGGTTGTGGGCGAAGCACGCAAGGAGGGCTTCAAGCTGTCTGTGTCAGACATCTTGCGCCATCAGACGCTG
CAGGACATTGTCAGCCACAGCTGCAAGGACATGGAGGATGTGCAGCGTCGTTTTGCCCCCTTTTGTCTCCTAGGC
GATGGATTTGACGCGGCGGACATTGCCAGACACTACCATCTCGACCCGGATGCCATTGTCGACGCCTATCCATGC
ACGCCGCTGCAGGAGGGTCTCATGACGCTGACGTCCAAGATTGATGGAACTTACATGACGCAAAACGTGCTGGAG
CTGGCCGACAACGTTGACGTGGACAAGCTGTGCGCGGCGTGGGAGCACGTGACTTGCGCTCTGCCGCTGCTACGT
ACCCGCATCGTCCAGAACAGCGACCTCAGTCTCCAGCAGATTGTGCTCGACCAAAAGATATGCTGGACTCGTGCC
ACGGGCTTGCAGAGCCATCTGGATGCTGATGGCCAACAGTCCATGCCTCTGGGGGAGCCCCTGGCCCGCTATGCC
CTGGTGAGCAACGAGACGGGCACAGTCAAATGGCTTGTGTGGACTGTGCATCACGCTCTCTACGACGGCTGGTCG
ATGCCTCTTGTCATCGACGCCGTCTACCAGGCCTATGAGGGAAAGCGACTCGATGACGAGTTTCCCCCGTTTCAA
GCCTTCATCGAGTACATCAAGGGCCAAGACGAGCAGGCGCTTTCAAGCTACTGGCAGGACGCCCTAGCCGATTGC
CAAAGCATCCCCTTTCCAGCTCTGCCGCCATCTCTTGAGCAGCAGCTGGCTCCTACCAGCCATGTCGAGCACTCT
TTGACACTGCCCACCAGCAAGACTCCCAATGTGACGGCGTCGACGCTGATTAGGGCAGCCTGGGCGTTTGTCGTC
GGCTGCATGACCGACTCGGACGATGTCGTTTTTGGAGCCACCGTGTCAGGGCGCAGCGCCCCCGTTGCTGGGCTG
GATAGGATGGCGGCGCCCACAATCGCCACTCTGCCTCTTCGGCTCCGACCCGAGGAATCCATAGTCGGTGCTGGG
CCCTTGGGCTCCTGGCTCGATAGCTCGCAGCCTCAATGGATCGACACGTACGCTCTGACGCTGGAGCTGCGGCTC
GGCGCCAAACGAGGTGCTGCTTTAGCCATCTTTGACTCGAGGGTCATTTCTCCGTGGCTGGTCCAGACCTTGTTA
CAGAGGCTAGATTTTGTCGTGCAGCAATTTAGCAACGCTAATCCCAGCCAAACACTGTCGAGTGTAGGCCTGATG
ACGCCGCAAGACTTGGAATCCATATGGCAGTGGAATGCCACAGTGCCTCTGCCTGCTACGCAAAGCGTTGCACAG
ATGATTGCTGAGCGTGTGCAAGCTCAGCCCGATGCCCCGGCCGTGTGTGCCTGGGACGGCGAACTGACCTATAGC
CAGCTAGACACTCTGGCCACAAGACTCGCTAACCTCCTTGTCGACCACGGAGTAGCAGCCCAGGTGCCCCTAGTG
CCGCTCTGCTTTGAAAAGAGCATGTGGACCACGGTGGCCATACTCGGCGTAGTCAAGGCCGGAGCCGCCTTTATT
CTGCTTGATCCAGCACTCCCCGAGCAACGCCTCAAATCCATCGTGCAACAAGTCAGGGCTAACCTCATCTTGACT
TGTCCCTCTGCCCAAGCCTTGAGCTCGCGCTTGGCAAATCAAACAATTACGCTGAGCTCGAGTCTGTTTGCCGAT
TTGCCAGACGGCGGGCGGCAACACGTGCCGGCGTTGTCTCTATCTTCTCTCTTATACATCCTCTTCACCTCGGGG
AGCACAGGCACGCCAAAGGGCGTCAAGATAACTCACCTTAACGCTGCGTCTGCTCTGGTCCATCAAACACACCGT
ATTGGGTTCACGCCTGAATCCCGAGTCTTTGACTTTGCCTCGTATAGCTTTGATGTATCCATTAGCAACGTCTTT
TCGACTTTGACGTCGGGTGCCTGTCTTTGCGTTCCCAAAGACCAAGATCGGCAGACCAACCTGGAACAAAGCATA
GCTTCTCTGCGCGCAAACGTGCTCGACATAACTCCAACACTCGCTCACATATTGTCACCAGCCAACATCCCCTTG
GTCAAGACAATCATCTTGAGTGGCGAGGCATTCCGTGCTGCTGACGTGGAAAAGTGGTTGCGGGCCGAGGTTCGC
CTTGTCAATGCTTACGGACCAAGCGAGTGCACCCCAACCGGCACACTCAACTGCAGCGCACGCACTCCACAAGCC
GTCGTTTCCATCGGCAAAGGCGTCGGTGTCGTGACATGGATAGTCAACCCGAACAGTCATGACCAACTCCTCCCA
CCTGGATCCGTCGGCGAACTGCTACTCGAGGGTCCCCTTGTTGGCAATGGTTATCTAGACGATCCTAAACGCACA
GCCGCTGTCTTCATTGACGACCCATCGTGGCTATTGCAAGGAGCGCCAGGTCAACCAGGACGCCATGGGCGGCTC
TACAAGACGGGAGATTTGGTGCGATATAACCAAGATGGAAGCTTGGTCTTTATTGGGCGCAAAGACACGCAGACC
AAGATTCGTGGACAGCGAGTGGAGCTCGAGGAAATCGAGCATCACGTCTGTCGATGCGTACCAAGCGTGAGACAA
GCCGTGGCTGAAGTTGTGACGCCCGATGACCAAGGAAGCCCAATGGTAGTCGTCTTTGTTGAGGTGGATGATGAA
GCGAGGACAGAGGAACGGGAGCGCACGGAGCCCAGCATAATGTCCATAACGCCACAGGTCGAAAGGCAGCTGGCA
GATCATCTTACAAGTTACATGATGCCTGCCTTCTTCCTGTCCATGGCAGAGCTTCCCGTGACGCCAACAGGCAAG
ACGGATCACAAGAAACTACGTCAGACTGGTCGGGATTTCTTGGCTGCTGGGGCAAAATCCCCCTCACTCCAGCTT
CTCGTCGGTGATGGCGAAACAATAACCAAGACTGAACAGCCCGCATATGCGCTTGCACAGAGCGTTTTTTCCATG
CTGCCCTCGTGGCGTCGTCAGTCTCTGTCAAGTCAAGACGCGTCTAGCTTCGAGAATGTCTTGCTGCAGCCTTGC
GGCCTCGACTCCATCAACATGATGTCGCTTATTCGCCATGTCTTGCGCGAGTTTGGTGTCAAGCTCAGTTTGGAG
CTTTTGTTGGACCGAACGACGAGCATCCGCACTTTGGCCAAATCAGTCTTGGATCTGCAAGACGCCCAAACGCAA
ACGTCGCAAGGGATGCTGCCCACTCACTACTCACCAAGCGTTGATATTATGGCTCAGGTAGAAAAACATGATGCC
ACTGTTGCCGCTGTCCAGCAGCAGGTGGCGTCTGCTGAAGCGTACACCAATGGCAACGACACAAATAGCCAAAAG
CCGTTGACCGTCTTGCTGACGGGTGCCAACGGATTCATTGGCTCACAGATTTTGCGCCAGCTTCTGGAAAGCAAA
ACGATTGGCCAAGTGGTGGCGGTGGTGCGCGGTGAGACTCGAGACGCCGCCAGAAAGCGCGCCATTAGTGCTGCC
AAAACGGCGCTCTGGTGGACGGATGAGCACGCCGACAAGCTGCAAGTCTGGCCTGGAGACCTATCTCTGCCGCAG
CTGGGGCTAGATGCAACGCACTGGGCACGCTTTGCCGACCAAGAGTGGTTTGACATTGTCATCCACAGCGGGGCC
GAGGTGCACTGGGGCAAAAACTACGCAAGCCTCGAGGCCACCAATGTGAGCTCGACTGTGGAGCTGCTTCGTACC
GTGGTGGCAGTCCCGGGAATGAAGTTTGTCTATGTCTCTGGTGGCAGAGATGGAGGAGCCGAGGATGAGGACGAG
GAGCAAGTGGCACAAGAGCTTGGAGCTCCCGGTGCCATTGGCTATAGCCAGACCAAGTTTGTTGCCGAGGCAGTT
GTCAAGCGCGCAGCAAAGCGCTGCGCCATGAGCCCGAGTCGTCTGGCCGTTGTGACGCCAGGCCTTGTTGTCGGG
ACGCCAACCGAGGGCGTGCCCAATGCCGATGATTACATGTGGCGACTGGCGGCCTCGTGTATCCGGGTTGGCATG
TACAATGCCGACGAGGCGGATGCCTGGCTTGCCCTATCCGACGTGGCGGCGCTTGCGGCCATTATTGTTGATTCA
GCCTTGCATCCAGACGCCGTGCCAGAGGCAAAACGCTATGTTAGGGATGGCATGAAGTGGCGTGACTTTTGGGCT
ATCCTGAGCGGCTTGGGCTACCAGTTGCAAGCCAAGCCGGTGACGCAGTGGCTAGCTGCTGTGCGAAAAGACATT
GACGCCGTGGGCGAGACCCATCCACTATGGCCACTGAAGCATCTCGTTGAGGAGGAGAGTTTGATGCAAAACAAT
GAGACGAGTGACTCGAGCAGCGAGGGCGAGACGCCGCACAGGTTGACTGTGGCGGTTGAGAAGAGCGCCCAGTTT
CTTTGCAAATGCGGGTTTTTTGAGCCGGTGCCTCTGGCTGATTGTCAGGGTGCGCCGCAAAGGGAGGTGGTGTCT
TGCAAGCCCTTTACGCGGTCCAAGAAGTAA
Transcript >OphauB2|6340
ATGGCCTTGACCCATGGTAACAATGGCTTTGGCCGTCTCGAGACTGCAGATCCTGAGGCTCCACACGCTGTCATC
ACCACCACGGTTCCTAGGACTCATGACACGGGAGCCAATGTCGACACCGCTGTCAATGGCTTCGACATGGCTGCA
ACTGCCAATATACTTAAGGCAGCCATGCTCGTGAGGCGCAATTCCTCCCAGGAGAGCATCACCGACTCTTCTCCA
GGCGCCATGTCAGACTACGATTCACTTGTCCCTACGCCACCCTTGTCTCCAGACAAACCATCGGCCTCTAGACTC
GTCCTCAACCACCGCATCAAACATGTCACAACGCTCGGGACTGGCAAGACCAAGACTAATCTGCTCGTCGCAGCT
TGGGCCATCGTTGCCAGTCAATTGCAGAATTCCAGCCATGTTGTACTTCAAGTTGCCATGGATCCAAGGGCACAT
GTGATAGCCTCGATACAAGTCGAGCTACACGGCGACACCAGCGTCACAGCCCTCGTGCAAACAGTGGAGAACCAG
ATGGCTGCCGTTGCTTCGTTGCCACTAGCCAACGGGCGGCCAAAAGATATTGAGCCAAGCAGCGGGCTTAACACG
CTGCTTATAATCGGGGGGAGCGAGACAGTTGACATGCAAAATGGCGGCATCGGGGACGGCCAGCAAGAGCAGTCC
AATTCGTACGGGCTGGTGCTCAGGGCCCATCTTGGAGACGAGATGCATGTGTCTGCTTGCTTTGATGCGCAGGTG
CTGGAGCCATGGACGGCAAACAGCCTGCTTCGACGGCTGAGCCATGTGATGCACCAGTTTAGTCAGGCAGATGCT
CAAAAGCCGCTAAGCCAGGTTGAAATGGCAAGCCAAGACTTGCAGCAGATTTGGAGGTGGAACGCTGTCGTGCCG
AGTGCAGTAGAGCGCTGTTTCCATGATGTCTTTCAAGACAGCGTGCGCCAACATGCCGACGCCTTGGCCATTGAT
GCCTGGGACGGCCAGCTTAGCTATACCAAGTTGCATCAGCTCTCCTGGGCTCTGGCAGACAAGTTGGTTGAGCTC
GGCGTCGGCCCAGGTGTCTTTGTGCCACTGTGCTTTGAAAAGTCTGTGTGGACATCTGTTGCCGTGCTCGCCGTC
TCCAAGGCGGGCGGCGCCTTTGTCCTGCTTGACCCCGGGCAACCGGAGCAGCGCCTTGACACCATTGTCGAGCAG
GTCCAGGGCCGATTGATACTGGCATCGTCGTCGATGCAAGCCCTGGCTGCCCGGCTGTGTCAACATGTATTGGCC
CTAGACTGGCGCTTCTTCAAAGACTTGACGCAGCAAAAACCAAGCTGCCCAAAGACTAGCTTGGTCCTGCCGTCA
TCTATTCTCTATGTCGTCTTCACATCCGGCAGCACGGGGAAGCCCAAGGGTGTCCTGATAAGCCACGCCAATGCT
GCGTCAGCTCTCTCCTACCAGGTGCAGCCAATGGGACTGACGGCCGACACACGCTTCTTTGACTTTTCATCATAT
AGCTTCGATGTGTCCATCAACAGTCTCTTTACCGTGCTGGCAGCGGGGGGCTGTCTCTGTGTTCCTAGTGAGACA
GACCGAAGAGATAACCTGTCCAAGAGCATTAATGACTTGGGCGCCAATTGGCTCGACCTGACGCCGTCCATTGTG
CGCAATCTCTGGCCTCAAGAACTGCCCAAGGTGCGCTGCATAACGCTTGGGGGTGAGGCTCTGCGTGCCACCGAT
GTGGAGCGTTTCTGGGGCAAGGTGCGAATCTTCAATGCCTACGGACCAAGTGAATGCACACCCACCAGTACCATC
AACTACGATGCCTCTAGCCTAGATGGCCTGACCCGCATTGGAAAGGGGCTGGGAGTGGTGACGTGGGTGGCGAGC
CCTGATGACCACAATACCTTGGTGCCGCCTGGCTGCATTGGCGAATTGCTCCTCGAAGGACCCCTCGTCGGCGGC
GGCTACCTCAACGACTCGGCCCGGACAGCCGCTGCCTTCATCGAGGACCCAACGTGGCTGACCTTGGGTGTGCCA
GGCGTCCAGCCAGGTCGTCGTGCCAGGCTGTACAAAACGGGTGATTTGGTCCGGTATCACGAGGACGGCAGCTTG
ATATACATTGGTAGAAAAGATGCCCAGGTCAAGATTCGCGGCCAGCGCGTCGAACTGGGAGATGTTGAGCATCAT
CTGGCCATGTGCTTGCCCTGGGCTCGAGAGGTGGCGGCCGAGGTGCTGGCATTCGAGGGCAGGCAGACGCTGGCC
GCCTTTGTTGTCAAGCCAGACAGCAGCAACAAGCAGACACAATGTACATCCATTTCTCTCTCGGCCGACGAGGAA
AGGCTGCTCGCCAGCCGTCTGCCCGTGTACATGGTGCCCACCATCTACCTTGGCCTTGAAAAGATGCCCGTCAAC
AGCGCGGGCAAGACAGACCGGAAGCAACTGCGAGCCCTAGGAGTCGAGGCGCTCAATATTCAGGCCCTTGATGTC
GACGATAATGTTTGTTGTAAAAGTAATGCCAATCCTGGTCAAGACGCTGCCGAGCTGGCTCTCCGGCGCATCTGG
GCCCGCGTCCTTAATGTCGCCGCCTCGCGCATTGGCTCCAACGTCAGCTTCTTCCGCCTTGGAGGTGATTCCATC
ACCGCCATGCAAGTGTCGGCCGCGGCACGGGCATCGGGCATGGACATTTCCACAGCCGACGTTTTGCGCCACAAG
ACCATTGCCGTCCTTGCCGCCACGGCCAAGCACCATGTTGCCTCGTCCGCCACGCAGCACCAGGGCCACGAGCAT
GATGGCCGCCCATTTCAATCCAGTCCCATGCAGCAGCTCTATCTCTCCTTTGAGCCTGATCCCACTCGCTGCTAC
GACCAAAACTTCCTGCTCAGGCTGCGCAGACCCCTGGCCCTTGACACACTGCAGCGAGCGCTTGAGGCAATTGTC
TCTCGACACGCCATGCTGCGCGCCCGTTTCACGCGAGCCGACAATGGTCAATGGACGCAGCGCATTGCAGCCCGC
CAAGACGCCTTGTCGTGCTTTTCTGTTTCCCAGGCTCCTCCAGACTCCAATCTTGCCCACACAATTCGCACCTGT
CGCCAACGCCTCGACATCATCAATGGCCCGCTGCTCGTGGCCGCCCTTGTCTTTGCAGGTCAAGGAGGCGACAAG
CCGGCCCAGAGCCTCTTCATTGCTATTCATCATCTTGTCATCGATCTCGTGTCGTGGCGTGTCTTGTTTCAAGAG
CTCGAGGAGCTCATCACCAAGGGACAAATCTTGTTGCCGCCGCCGTCTGTGAGCTTCCCTGCATGGAGCACAATG
CAGGCAGCATATGCCAACGAGAAGCTCAGTCTCGACACCACTCAGGACGCGCCGCCTCCGCTCTTGTCGTACTGG
GGTATCGATGCAGCCAGCAACGTCGACGGCGCTACAGCGTCCCTGACCTTTGTCGTCGACGAGCAGTCAAGTGCT
GCCTTGCTTGGTCCTGCCAACCAGGCCTTGAATACCAAGCCAGTCGAGCTGCTCGTGGCATCCCTGATACGTTCC
TTTGCCGTCACATTTCCAGACCGTCCTGTTCCCGCCGTATTCAACGAGGGCCACGGTCGCGAGCCCTGGGAAGAC
GACATTGACGTCTCGCGCACTGTGGGCTGGTTCACCACCATGTATCCCATTCATGTGCCTGCCGTCAAATTACTG
GATGCACTGCGACGTACAAAGGACCAAGCTAGAGGGCTGGCAAAAAATGGTTGGAGCTACTTCACATCGCGTTTT
GCCAGTGCAAATCGTGCAGCAACCAGTGCTTGCCAGTTCCCTGTAGAAGTCGTCCTCAACTTTGCCGGCTCCTAC
CAGCAGTTGGAGCGAACCGACTCCATCTTTGAGTTGGTCCCCTTGCCAAACGATTGCCGTCCAGCCTCGGCGGCT
GGTTTGCGTCGTTTCGAGCTCTTCGAGGTGCACGTTCAAGTCAACCGAGGACGGTTGGCTGTCTCGCTGCTCTAT
CCCAAGTACGCACGTCACCAGGAGCGCATTGCAGCATGGATGGACTGCTACCAGGCCACTCTGGCACAGGCTGCC
AGCCTGCTGGCGCACAAGCCGCTTCAGTGGACACTGTCCGACTTTCCACTGGCCTTTTCCTCCTATGACAGTATC
CACGAATTCCAGATCCGGCTTCTGCCTGAGCTGGGTATCACTGGCCCAGACCAAGTAGAGGACGTGTTTCCTTGC
ACCGGCATCCAAGAAGGCATGCTGCTCGCTCAAGCCAAAGACTCGGCAAACTATCGATCAGCGCTCAGCTTCGAT
ATTCGAACCACCAAGCCGGGGCAGGTAATCAGCTTTGATAGGATTGAAGGCGCCTGGAGAGCCGTTGTGCGTCGC
CACTCGCTGCTACGCGCAATTCTCGTCGACACGGTGCCGGGGACTGGCAGAACCATGCACGTCGTTTTGGCCGAT
CCGATGCCCGACATGACATTTATGACGACGGCCAGCAAAAACAAAAGCAGCCAGGCAGTCGTGGGCTACCAGAAG
CATCAGTTGCAGCATCACATGACAGTGATTCGGGTCGATGAGACGCGAGTCCAAGTCCAGCTCGAGATTAACCAC
GCCATTGTCGACGGCTACTCGGATGGCATCATTTTGCACGACTTTTGGCAGGCGTATAGCGGCAGTCTGAGTCCC
CAAGGTCCTCTTTTCCGAGACTATGTTGCCCATATCGAGCAGCAGCAGTCACAGACCTCTGGCAGAGACTTTTGG
GCCAACCATCTCGATAGTGTGCAACCGTGTATTTTCCCCGTCTCCAAGGCTGGCAAAGAGCAAATGAAGGAGTTC
AACGTAGCTGTTGAGGGGCTGGATACAGCCAAAATTCATGCCTTTTGCGCCAGACATGAGCTGACAACGGCTTCC
GTCGTCCAACTTGCTTGGGCATTGGTGCTTCGCCAGTACACAGCATCAACATCGCCATGCTTTGGAAACATGACG
TCCAGCCGGGGCGTGGCCATCAAAGACATTGGAGATATGCTGGGGCCAGTCATTGGCTTGACGCCACGCCGCATC
AACCTCGACACGGAGCTCTCCGTCATGGAGACGTTGCGTCAAGTGCATGCCTATCACCTCGACAGCTTGCCGTAC
CAGACGAATTCGCTCCTCGACATTCAGCGCCACATAAAAATAGGACAGCACCGACTCTTCAACACCATTATGAGC
TTTCAAAAGGAGCGCTCTGGGCTCCTGCCATCAGCAGACGGACATATCCTTGATGAAGGGGCCATTGTGGATCCT
GTCGAGTACGAGGTTGCTGTCAATATCGAGGATAGCGACGAAGAATTGTCCATCCAGCTAGCCTTTCATGCTGGC
GTGCTGGGCGGCCATGAGGCAGAGCGAGTGTCACGTACTCTGGGAGCCGCCATCTCCTTGATTGTCAGCGACTAT
GGCGCCAAAATGAGCAGCGCCAGTCCTTTACACGACAACGACTTGGAGCAGCTCTGGTCTGCCAACAGTGTCGTG
CCAGCAGCGGCTGAGCAGTGTATCCACGACGTGATTGGGGCGGTAGCCCAGAGCCAGCCCGATGCACAGGCAGTG
TGTGCTTGGGACGGGGACCTGACGTACGAGCAACTGATGCATTTTGCCTCAGTGCTAGCTAGACGTCTGATTGCC
ATGGGCGTGGGACCGGGCACCACTGTACCGCTATGCTTTGAGAAATCAAAATGGACGCCGGTTGCCACGCTTGCA
GTCGCCCAGACCGGAGCCGCCTTTGTTTCCCTTGACCCGGCACTTCCAGAGCAACGGCTTACATCCATTGTCCAG
CAGGTGCAAGCAGGCCTGTTGCTCTCGTCTCCTTGCCACCAGCAACTGGGTATGCGACTTTGTCCACAAGTACTG
GCCATCAGCCACGGCTTCTTTGCTGAGACGAGCCATGACACGGCTATTCCGCTACCAAGCGTCGATTTGGACTCT
TTGATCTATTTCGTCTTCACCTCTGGAACCACTGGAGTGCCCAAGGGCGTCATGACGATGCATAGAGCATCTGCA
TCCGCGGTCAAGTATCAAGTGCAAGGCCTGAAATACACGACCAAGACGAGGGTCTATGACTTCTCCACGTATAGT
TTCGACGCCGCCATCAGCAACATCTTTACCGTCTTGGCTGCAGGAGGCTGCTTGTGTGTTCCGGCAGACCAGGAC
AGAATATCCAATCTCGAAATGAGCCTCAACTCTTTGAAAGCCACGGCTGTACTTCTCACGCCTTCCGTGGCCCAG
CTTCTATGTCCAGATCGGCTGCCTTACCTCGAAGCTGTGATCCTCATGGGAGAAAAGGTTCGCGTCAAGGATATT
GAGCCATGGTGGGGAAGAGGCTTTACCCTTTATGGGCCGAGCGAGTGTACACCCGTAAGTTTAATCAACCCCAAT
CCAACAAGTCCTGAGCAGGCCGTTTGTCTGGGTCAAGGCTTTGGTTCTGTGCCATGGATTGTGGACGCAAAAGAT
CACAACCGCTTGCTGCCTCCGGGCTGCGTTGGCGAGCTTTTGATTGAAGGGCCAATAGTGGGTGCCGGCTATCTT
GGCAATGCAGAGAAAACAGCAGCTGCCTTTATCGAAGACCCGACTTGGATGGTCCGAGGGGCTCCCGGTAGGCCA
GGCCGTCACGGTCGCCTCTATAAGACGGGAGATCTGGTTTGCCTCGATGATGAGGGGAATATCTCGTTTCTTGAG
CGCAAGGACATGCAAATAAAGATCCGAGGCCAGCGGGTGGAGCTGGCAGAGATTGAACACTGGGTCCGCATCTGC
ATGCCCGAGACTCCCCATGTCATAGTTGAAGTGGTTGAGCCAGAAGGGAAAAGCTCAAGTGCGTTTGTCGCTCTA
TTCCTTGACATGGACACGGAAACGGTTGCCTTGGCGCCTGATTCTGTCAAGGTGCTGCCTGTGCCTGCAAAAGTG
CAGGCCAAGCTGGCCGAGCACCTGCCAAGCTACATGGTGTCGACAGTCATGTTTTCCCTGCAGATACCGACGACT
GTGAGTGGGAAAACGGATAGAAGACGGTTACGCGAGATTGGAGCTTCATTCTCGCTTGATCAGCTGGCTGAAATG
CGCACTGCGGGCATAGAAAGCAAGCAGAAGCCCCTGTCCAAGATGGAACAGCTCCTACAAGACATCTGGGCCCGC
GTGCTCAATATGAAAGCCTCGGTAATTGGAGTCCAAGATAGCTTCTTCCGCCTCGGCGGTGACTCGATTGCTGCA
ATCAGGGTTGTGGGCGAAGCACGCAAGGAGGGCTTCAAGCTGTCTGTGTCAGACATCTTGCGCCATCAGACGCTG
CAGGACATTGTCAGCCACAGCTGCAAGGACATGGAGGATGTGCAGCGTCGTTTTGCCCCCTTTTGTCTCCTAGGC
GATGGATTTGACGCGGCGGACATTGCCAGACACTACCATCTCGACCCGGATGCCATTGTCGACGCCTATCCATGC
ACGCCGCTGCAGGAGGGTCTCATGACGCTGACGTCCAAGATTGATGGAACTTACATGACGCAAAACGTGCTGGAG
CTGGCCGACAACGTTGACGTGGACAAGCTGTGCGCGGCGTGGGAGCACGTGACTTGCGCTCTGCCGCTGCTACGT
ACCCGCATCGTCCAGAACAGCGACCTCAGTCTCCAGCAGATTGTGCTCGACCAAAAGATATGCTGGACTCGTGCC
ACGGGCTTGCAGAGCCATCTGGATGCTGATGGCCAACAGTCCATGCCTCTGGGGGAGCCCCTGGCCCGCTATGCC
CTGGTGAGCAACGAGACGGGCACAGTCAAATGGCTTGTGTGGACTGTGCATCACGCTCTCTACGACGGCTGGTCG
ATGCCTCTTGTCATCGACGCCGTCTACCAGGCCTATGAGGGAAAGCGACTCGATGACGAGTTTCCCCCGTTTCAA
GCCTTCATCGAGTACATCAAGGGCCAAGACGAGCAGGCGCTTTCAAGCTACTGGCAGGACGCCCTAGCCGATTGC
CAAAGCATCCCCTTTCCAGCTCTGCCGCCATCTCTTGAGCAGCAGCTGGCTCCTACCAGCCATGTCGAGCACTCT
TTGACACTGCCCACCAGCAAGACTCCCAATGTGACGGCGTCGACGCTGATTAGGGCAGCCTGGGCGTTTGTCGTC
GGCTGCATGACCGACTCGGACGATGTCGTTTTTGGAGCCACCGTGTCAGGGCGCAGCGCCCCCGTTGCTGGGCTG
GATAGGATGGCGGCGCCCACAATCGCCACTCTGCCTCTTCGGCTCCGACCCGAGGAATCCATAGTCGGTGCTGGG
CCCTTGGGCTCCTGGCTCGATAGCTCGCAGCCTCAATGGATCGACACGTACGCTCTGACGCTGGAGCTGCGGCTC
GGCGCCAAACGAGGTGCTGCTTTAGCCATCTTTGACTCGAGGGTCATTTCTCCGTGGCTGGTCCAGACCTTGTTA
CAGAGGCTAGATTTTGTCGTGCAGCAATTTAGCAACGCTAATCCCAGCCAAACACTGTCGAGTGTAGGCCTGATG
ACGCCGCAAGACTTGGAATCCATATGGCAGTGGAATGCCACAGTGCCTCTGCCTGCTACGCAAAGCGTTGCACAG
ATGATTGCTGAGCGTGTGCAAGCTCAGCCCGATGCCCCGGCCGTGTGTGCCTGGGACGGCGAACTGACCTATAGC
CAGCTAGACACTCTGGCCACAAGACTCGCTAACCTCCTTGTCGACCACGGAGTAGCAGCCCAGGTGCCCCTAGTG
CCGCTCTGCTTTGAAAAGAGCATGTGGACCACGGTGGCCATACTCGGCGTAGTCAAGGCCGGAGCCGCCTTTATT
CTGCTTGATCCAGCACTCCCCGAGCAACGCCTCAAATCCATCGTGCAACAAGTCAGGGCTAACCTCATCTTGACT
TGTCCCTCTGCCCAAGCCTTGAGCTCGCGCTTGGCAAATCAAACAATTACGCTGAGCTCGAGTCTGTTTGCCGAT
TTGCCAGACGGCGGGCGGCAACACGTGCCGGCGTTGTCTCTATCTTCTCTCTTATACATCCTCTTCACCTCGGGG
AGCACAGGCACGCCAAAGGGCGTCAAGATAACTCACCTTAACGCTGCGTCTGCTCTGGTCCATCAAACACACCGT
ATTGGGTTCACGCCTGAATCCCGAGTCTTTGACTTTGCCTCGTATAGCTTTGATGTATCCATTAGCAACGTCTTT
TCGACTTTGACGTCGGGTGCCTGTCTTTGCGTTCCCAAAGACCAAGATCGGCAGACCAACCTGGAACAAAGCATA
GCTTCTCTGCGCGCAAACGTGCTCGACATAACTCCAACACTCGCTCACATATTGTCACCAGCCAACATCCCCTTG
GTCAAGACAATCATCTTGAGTGGCGAGGCATTCCGTGCTGCTGACGTGGAAAAGTGGTTGCGGGCCGAGGTTCGC
CTTGTCAATGCTTACGGACCAAGCGAGTGCACCCCAACCGGCACACTCAACTGCAGCGCACGCACTCCACAAGCC
GTCGTTTCCATCGGCAAAGGCGTCGGTGTCGTGACATGGATAGTCAACCCGAACAGTCATGACCAACTCCTCCCA
CCTGGATCCGTCGGCGAACTGCTACTCGAGGGTCCCCTTGTTGGCAATGGTTATCTAGACGATCCTAAACGCACA
GCCGCTGTCTTCATTGACGACCCATCGTGGCTATTGCAAGGAGCGCCAGGTCAACCAGGACGCCATGGGCGGCTC
TACAAGACGGGAGATTTGGTGCGATATAACCAAGATGGAAGCTTGGTCTTTATTGGGCGCAAAGACACGCAGACC
AAGATTCGTGGACAGCGAGTGGAGCTCGAGGAAATCGAGCATCACGTCTGTCGATGCGTACCAAGCGTGAGACAA
GCCGTGGCTGAAGTTGTGACGCCCGATGACCAAGGAAGCCCAATGGTAGTCGTCTTTGTTGAGGTGGATGATGAA
GCGAGGACAGAGGAACGGGAGCGCACGGAGCCCAGCATAATGTCCATAACGCCACAGGTCGAAAGGCAGCTGGCA
GATCATCTTACAAGTTACATGATGCCTGCCTTCTTCCTGTCCATGGCAGAGCTTCCCGTGACGCCAACAGGCAAG
ACGGATCACAAGAAACTACGTCAGACTGGTCGGGATTTCTTGGCTGCTGGGGCAAAATCCCCCTCACTCCAGCTT
CTCGTCGGTGATGGCGAAACAATAACCAAGACTGAACAGCCCGCATATGCGCTTGCACAGAGCGTTTTTTCCATG
CTGCCCTCGTGGCGTCGTCAGTCTCTGTCAAGTCAAGACGCGTCTAGCTTCGAGAATGTCTTGCTGCAGCCTTGC
GGCCTCGACTCCATCAACATGATGTCGCTTATTCGCCATGTCTTGCGCGAGTTTGGTGTCAAGCTCAGTTTGGAG
CTTTTGTTGGACCGAACGACGAGCATCCGCACTTTGGCCAAATCAGTCTTGGATCTGCAAGACGCCCAAACGCAA
ACGTCGCAAGGGATGCTGCCCACTCACTACTCACCAAGCGTTGATATTATGGCTCAGGTAGAAAAACATGATGCC
ACTGTTGCCGCTGTCCAGCAGCAGGTGGCGTCTGCTGAAGCGTACACCAATGGCAACGACACAAATAGCCAAAAG
CCGTTGACCGTCTTGCTGACGGGTGCCAACGGATTCATTGGCTCACAGATTTTGCGCCAGCTTCTGGAAAGCAAA
ACGATTGGCCAAGTGGTGGCGGTGGTGCGCGGTGAGACTCGAGACGCCGCCAGAAAGCGCGCCATTAGTGCTGCC
AAAACGGCGCTCTGGTGGACGGATGAGCACGCCGACAAGCTGCAAGTCTGGCCTGGAGACCTATCTCTGCCGCAG
CTGGGGCTAGATGCAACGCACTGGGCACGCTTTGCCGACCAAGAGTGGTTTGACATTGTCATCCACAGCGGGGCC
GAGGTGCACTGGGGCAAAAACTACGCAAGCCTCGAGGCCACCAATGTGAGCTCGACTGTGGAGCTGCTTCGTACC
GTGGTGGCAGTCCCGGGAATGAAGTTTGTCTATGTCTCTGGTGGCAGAGATGGAGGAGCCGAGGATGAGGACGAG
GAGCAAGTGGCACAAGAGCTTGGAGCTCCCGGTGCCATTGGCTATAGCCAGACCAAGTTTGTTGCCGAGGCAGTT
GTCAAGCGCGCAGCAAAGCGCTGCGCCATGAGCCCGAGTCGTCTGGCCGTTGTGACGCCAGGCCTTGTTGTCGGG
ACGCCAACCGAGGGCGTGCCCAATGCCGATGATTACATGTGGCGACTGGCGGCCTCGTGTATCCGGGTTGGCATG
TACAATGCCGACGAGGCGGATGCCTGGCTTGCCCTATCCGACGTGGCGGCGCTTGCGGCCATTATTGTTGATTCA
GCCTTGCATCCAGACGCCGTGCCAGAGGCAAAACGCTATGTTAGGGATGGCATGAAGTGGCGTGACTTTTGGGCT
ATCCTGAGCGGCTTGGGCTACCAGTTGCAAGCCAAGCCGGTGACGCAGTGGCTAGCTGCTGTGCGAAAAGACATT
GACGCCGTGGGCGAGACCCATCCACTATGGCCACTGAAGCATCTCGTTGAGGAGGAGAGTTTGATGCAAAACAAT
GAGACGAGTGACTCGAGCAGCGAGGGCGAGACGCCGCACAGGTTGACTGTGGCGGTTGAGAAGAGCGCCCAGTTT
CTTTGCAAATGCGGGTTTTTTGAGCCGGTGCCTCTGGCTGATTGTCAGGGTGCGCCGCAAAGGGAGGTGGTGTCT
TGCAAGCCCTTTACGCGGTCCAAGAAGTAA
Gene >OphauB2|6340
ATGGCCTTGACCCATGGTAACAATGGCTTTGGCCGTCTCGAGACTGCAGATCCTGAGGCTCCACACGCTGTCATC
ACCACCACGGTTCCTAGGACTCATGACACGGGAGCCAATGTCGACACCGCTGTCAATGGCTTCGACATGGCTGCA
ACTGCCAATATACTTAAGGCAGCCATGCTCGTGAGGCGCAATTCCTCCCAGGAGAGCATCACCGACTCTTCTCCA
GGCGCCATGTCAGACTACGATTCACTTGTCCCTACGCCACCCTTGTCTCCAGACAAACCATCGGCCTCTAGACTC
GTCCTCAACCACCGCATCAAACATGTCACAACGCTCGGGACTGGCAAGACCAAGACTAATCTGCTCGTCGCAGCT
TGGGCCATCGTTGCCAGTCAATTGCAGAATTCCAGCCATGTTGTACTTCAAGTTGCCATGGATCCAAGGGCACAT
GTGATAGCCTCGATACAAGTCGAGCTACACGGCGACACCAGCGTCACAGCCCTCGTGCAAACAGTGGAGAACCAG
ATGGCTGCCGTTGCTTCGTTGCCACTAGCCAACGGGCGGCCAAAAGATATTGAGCCAAGCAGCGGGCTTAACACG
CTGCTTATAATCGGGGGGAGCGAGACAGTTGACATGCAAAATGGCGGCATCGGGGACGGCCAGCAAGAGCAGTCC
AATTCGTACGGGCTGGTGCTCAGGGCCCATCTTGGAGACGAGATGCATGTGTCTGCTTGCTTTGATGCGCAGGTG
CTGGAGCCATGGACGGCAAACAGCCTGCTTCGACGGCTGAGCCATGTGATGCACCAGTTTAGTCAGGCAGATGCT
CAAAAGCCGCTAAGCCAGGTTGAAATGGCAAGCCAAGACTTGCAGCAGATTTGGAGGTGGAACGCTGTCGTGCCG
AGTGCAGTAGAGCGCTGTTTCCATGATGTCTTTCAAGACAGCGTGCGCCAACATGCCGACGCCTTGGCCATTGAT
GCCTGGGACGGCCAGCTTAGCTATACCAAGTTGCATCAGCTCTCCTGGGCTCTGGCAGACAAGTTGGTTGAGCTC
GGCGTCGGCCCAGGTGTCTTTGTGCCACTGTGCTTTGAAAAGTCTGTGTGGACATCTGTTGCCGTGCTCGCCGTC
TCCAAGGCGGGCGGCGCCTTTGTCCTGCTTGACCCCGGGCAACCGGAGCAGCGCCTTGACACCATTGTCGAGCAG
GTCCAGGGCCGATTGATACTGGCATCGTCGTCGATGCAAGCCCTGGCTGCCCGGCTGTGTCAACATGTATTGGCC
CTAGACTGGCGCTTCTTCAAAGACTTGACGCAGCAAAAACCAAGCTGCCCAAAGACTAGCTTGGTCCTGCCGTCA
TCTATTCTCTATGTCGTCTTCACATCCGGCAGCACGGGGAAGCCCAAGGGTGTCCTGATAAGCCACGCCAATGCT
GCGTCAGCTCTCTCCTACCAGGTGCAGCCAATGGGACTGACGGCCGACACACGCTTCTTTGACTTTTCATCATAT
AGCTTCGATGTGTCCATCAACAGTCTCTTTACCGTGCTGGCAGCGGGGGGCTGTCTCTGTGTTCCTAGTGAGACA
GACCGAAGAGATAACCTGTCCAAGAGCATTAATGACTTGGGCGCCAATTGGCTCGACCTGACGCCGTCCATTGTG
CGCAATCTCTGGCCTCAAGAACTGCCCAAGGTGCGCTGCATAACGCTTGGGGGTGAGGCTCTGCGTGCCACCGAT
GTGGAGCGTTTCTGGGGCAAGGTGCGAATCTTCAATGCCTACGGACCAAGTGAATGCACACCCACCAGTACCATC
AACTACGATGCCTCTAGCCTAGATGGCCTGACCCGCATTGGAAAGGGGCTGGGAGTGGTGACGTGGGTGGCGAGC
CCTGATGACCACAATACCTTGGTGCCGCCTGGCTGCATTGGCGAATTGCTCCTCGAAGGACCCCTCGTCGGCGGC
GGCTACCTCAACGACTCGGCCCGGACAGCCGCTGCCTTCATCGAGGACCCAACGTGGCTGACCTTGGGTGTGCCA
GGCGTCCAGCCAGGTCGTCGTGCCAGGCTGTACAAAACGGGTGATTTGGTCCGGTATCACGAGGACGGCAGCTTG
ATATACATTGGTAGAAAAGATGCCCAGGTCAAGATTCGCGGCCAGCGCGTCGAACTGGGAGATGTTGAGCATCAT
CTGGCCATGTGCTTGCCCTGGGCTCGAGAGGTGGCGGCCGAGGTGCTGGCATTCGAGGGCAGGCAGACGCTGGCC
GCCTTTGTTGTCAAGCCAGACAGCAGCAACAAGCAGACACAATGTACATCCATTTCTCTCTCGGCCGACGAGGAA
AGGCTGCTCGCCAGCCGTCTGCCCGTGTACATGGTGCCCACCATCTACCTTGGCCTTGAAAAGATGCCCGTCAAC
AGCGCGGGCAAGACAGACCGGAAGCAACTGCGAGCCCTAGGAGTCGAGGCGCTCAATATTCAGGCCCTTGATGTC
GACGATAATGTTTGTTGTAAAAGTAATGCCAATCCTGGTCAAGACGCTGCCGAGCTGGCTCTCCGGCGCATCTGG
GCCCGCGTCCTTAATGTCGCCGCCTCGCGCATTGGCTCCAACGTCAGCTTCTTCCGCCTTGGAGGTGATTCCATC
ACCGCCATGCAAGTGTCGGCCGCGGCACGGGCATCGGGCATGGACATTTCCACAGCCGACGTTTTGCGCCACAAG
ACCATTGCCGTCCTTGCCGCCACGGCCAAGCACCATGTTGCCTCGTCCGCCACGCAGCACCAGGGCCACGAGCAT
GATGGCCGCCCATTTCAATCCAGTCCCATGCAGCAGCTCTATCTCTCCTTTGAGCCTGATCCCACTCGCTGCTAC
GACCAAAACTTCCTGCTCAGGCTGCGCAGACCCCTGGCCCTTGACACACTGCAGCGAGCGCTTGAGGCAATTGTC
TCTCGACACGCCATGCTGCGCGCCCGTTTCACGCGAGCCGACAATGGTCAATGGACGCAGCGCATTGCAGCCCGC
CAAGACGCCTTGTCGTGCTTTTCTGTTTCCCAGGCTCCTCCAGACTCCAATCTTGCCCACACAATTCGCACCTGT
CGCCAACGCCTCGACATCATCAATGGCCCGCTGCTCGTGGCCGCCCTTGTCTTTGCAGGTCAAGGAGGCGACAAG
CCGGCCCAGAGCCTCTTCATTGCTATTCATCATCTTGTCATCGATCTCGTGTCGTGGCGTGTCTTGTTTCAAGAG
CTCGAGGAGCTCATCACCAAGGGACAAATCTTGTTGCCGCCGCCGTCTGTGAGCTTCCCTGCATGGAGCACAATG
CAGGCAGCATATGCCAACGAGAAGCTCAGTCTCGACACCACTCAGGACGCGCCGCCTCCGCTCTTGTCGTACTGG
GGTATCGATGCAGCCAGCAACGTCGACGGCGCTACAGCGTCCCTGACCTTTGTCGTCGACGAGCAGTCAAGTGCT
GCCTTGCTTGGTCCTGCCAACCAGGCCTTGAATACCAAGCCAGTCGAGCTGCTCGTGGCATCCCTGATACGTTCC
TTTGCCGTCACATTTCCAGACCGTCCTGTTCCCGCCGTATTCAACGAGGGCCACGGTCGCGAGCCCTGGGAAGAC
GACATTGACGTCTCGCGCACTGTGGGCTGGTTCACCACCATGTATCCCATTCATGTGCCTGCCGTCAAATTACTG
GATGCACTGCGACGTACAAAGGACCAAGCTAGAGGGCTGGCAAAAAATGGTTGGAGCTACTTCACATCGCGTTTT
GCCAGTGCAAATCGTGCAGCAACCAGTGCTTGCCAGTTCCCTGTAGAAGTCGTCCTCAACTTTGCCGGCTCCTAC
CAGCAGTTGGAGCGAACCGACTCCATCTTTGAGTTGGTCCCCTTGCCAAACGATTGCCGTCCAGCCTCGGCGGCT
GGTTTGCGTCGTTTCGAGCTCTTCGAGGTGCACGTTCAAGTCAACCGAGGACGGTTGGCTGTCTCGCTGCTCTAT
CCCAAGTACGCACGTCACCAGGAGCGCATTGCAGCATGGATGGACTGCTACCAGGCCACTCTGGCACAGGCTGCC
AGCCTGCTGGCGCACAAGCCGCTTCAGTGGACACTGTCCGACTTTCCACTGGCCTTTTCCTCCTATGACAGTATC
CACGAATTCCAGATCCGGCTTCTGCCTGAGCTGGGTATCACTGGCCCAGACCAAGTAGAGGACGTGTTTCCTTGC
ACCGGCATCCAAGAAGGCATGCTGCTCGCTCAAGCCAAAGACTCGGCAAACTATCGATCAGCGCTCAGCTTCGAT
ATTCGAACCACCAAGCCGGGGCAGGTAATCAGCTTTGATAGGATTGAAGGCGCCTGGAGAGCCGTTGTGCGTCGC
CACTCGCTGCTACGCGCAATTCTCGTCGACACGGTGCCGGGGACTGGCAGAACCATGCACGTCGTTTTGGCCGAT
CCGATGCCCGACATGACATTTATGACGACGGCCAGCAAAAACAAAAGCAGCCAGGCAGTCGTGGGCTACCAGAAG
CATCAGTTGCAGCATCACATGACAGTGATTCGGGTCGATGAGACGCGAGTCCAAGTCCAGCTCGAGATTAACCAC
GCCATTGTCGACGGCTACTCGGATGGCATCATTTTGCACGACTTTTGGCAGGCGTATAGCGGCAGTCTGAGTCCC
CAAGGTCCTCTTTTCCGAGACTATGTTGCCCATATCGAGCAGCAGCAGTCACAGACCTCTGGCAGAGACTTTTGG
GCCAACCATCTCGATAGTGTGCAACCGTGTATTTTCCCCGTCTCCAAGGCTGGCAAAGAGCAAATGAAGGAGTTC
AACGTAGCTGTTGAGGGGCTGGATACAGCCAAAATTCATGCCTTTTGCGCCAGACATGAGCTGACAACGGCTTCC
GTCGTCCAACTTGCTTGGGCATTGGTGCTTCGCCAGTACACAGCATCAACATCGCCATGCTTTGGAAACATGACG
TCCAGCCGGGGCGTGGCCATCAAAGACATTGGAGATATGCTGGGGCCAGTCATTGGCTTGACGCCACGCCGCATC
AACCTCGACACGGAGCTCTCCGTCATGGAGACGTTGCGTCAAGTGCATGCCTATCACCTCGACAGCTTGCCGTAC
CAGACGAATTCGCTCCTCGACATTCAGCGCCACATAAAAATAGGACAGCACCGACTCTTCAACACCATTATGAGC
TTTCAAAAGGAGCGCTCTGGGCTCCTGCCATCAGCAGACGGACATATCCTTGATGAAGGGGCCATTGTGGATCCT
GTCGAGGTAAGCTAACATCAACGGCACTACTAGATGTGATTAATAGAGGACTGACGAAACGACTTCTTCTAGTAC
GAGGTTGCTGTCAATATCGAGGATAGCGACGAAGAATTGTCCATCCAGCTAGCCTTTCATGCTGGCGTGCTGGGC
GGCCATGAGGCAGAGCGAGTGTCACGTACTCTGGGAGCCGCCATCTCCTTGATTGTCAGCGACTATGGCGCCAAA
ATGAGCAGCGCCAGTCCTTTACACGACAACGACTTGGAGCAGCTCTGGTCTGCCAACAGTGTCGTGCCAGCAGCG
GCTGAGCAGTGTATCCACGACGTGATTGGGGCGGTAGCCCAGAGCCAGCCCGATGCACAGGCAGTGTGTGCTTGG
GACGGGGACCTGACGTACGAGCAACTGATGCATTTTGCCTCAGTGCTAGCTAGACGTCTGATTGCCATGGGCGTG
GGACCGGGCACCACTGTACCGCTATGCTTTGAGAAATCAAAATGGACGCCGGTTGCCACGCTTGCAGTCGCCCAG
ACCGGAGCCGCCTTTGTTTCCCTTGACCCGGCACTTCCAGAGCAACGGCTTACATCCATTGTCCAGCAGGTGCAA
GCAGGCCTGTTGCTCTCGTCTCCTTGCCACCAGCAACTGGGTATGCGACTTTGTCCACAAGTACTGGCCATCAGC
CACGGCTTCTTTGCTGAGACGAGCCATGACACGGCTATTCCGCTACCAAGCGTCGATTTGGACTCTTTGATCTAT
TTCGTCTTCACCTCTGGAACCACTGGAGTGCCCAAGGGCGTCATGACGATGCATAGAGCATCTGCATCCGCGGTC
AAGTATCAAGTGCAAGGCCTGAAATACACGACCAAGACGAGGGTCTATGACTTCTCCACGTATAGTTTCGACGCC
GCCATCAGCAACATCTTTACCGTCTTGGCTGCAGGAGGCTGCTTGTGTGTTCCGGCAGACCAGGACAGAATATCC
AATCTCGAAATGAGCCTCAACTCTTTGAAAGCCACGGCTGTACTTCTCACGCCTTCCGTGGCCCAGCTTCTATGT
CCAGATCGGCTGCCTTACCTCGAAGCTGTGATCCTCATGGGAGAAAAGGTTCGCGTCAAGGATATTGAGCCATGG
TGGGGAAGAGGCTTTACCCTTTATGGGCCGAGCGAGTGTACACCCGTAAGTTTAATCAACCCCAATCCAACAAGT
CCTGAGCAGGCCGTTTGTCTGGGTCAAGGCTTTGGTTCTGTGCCATGGATTGTGGACGCAAAAGATCACAACCGC
TTGCTGCCTCCGGGCTGCGTTGGCGAGCTTTTGATTGAAGGGCCAATAGTGGGTGCCGGCTATCTTGGCAATGCA
GAGAAAACAGCAGCTGCCTTTATCGAAGACCCGACTTGGATGGTCCGAGGGGCTCCCGGTAGGCCAGGCCGTCAC
GGTCGCCTCTATAAGACGGGAGATCTGGTTTGCCTCGATGATGAGGGGAATATCTCGTTTCTTGAGCGCAAGGAC
ATGCAAATAAAGATCCGAGGCCAGCGGGTGGAGCTGGCAGAGATTGAACACTGGGTCCGCATCTGCATGCCCGAG
ACTCCCCATGTCATAGTTGAAGTGGTTGAGCCAGAAGGGAAAAGCTCAAGTGCGTTTGTCGCTCTATTCCTTGAC
ATGGACACGGAAACGGTTGCCTTGGCGCCTGATTCTGTCAAGGTGCTGCCTGTGCCTGCAAAAGTGCAGGCCAAG
CTGGCCGAGCACCTGCCAAGCTACATGGTGTCGACAGTCATGTTTTCCCTGCAGATACCGACGACTGTGAGTGGG
AAAACGGATAGAAGACGGTTACGCGAGATTGGAGCTTCATTCTCGCTTGATCAGCTGGCTGAAATGCGCACTGCG
GGCATAGAAAGCAAGCAGAAGCCCCTGTCCAAGATGGAACAGCTCCTACAAGACATCTGGGCCCGCGTGCTCAAT
ATGAAAGCCTCGGTAATTGGAGTCCAAGATAGCTTCTTCCGCCTCGGCGGTGACTCGATTGCTGCAATCAGGGTT
GTGGGCGAAGCACGCAAGGAGGGCTTCAAGCTGTCTGTGTCAGACATCTTGCGCCATCAGACGCTGCAGGACATT
GTCAGCCACAGCTGCAAGGACATGGAGGATGTGCAGCGTCGTTTTGCCCCCTTTTGTCTCCTAGGCGATGGATTT
GACGCGGCGGACATTGCCAGACACTACCATCTCGACCCGGATGCCATTGTCGACGCCTATCCATGCACGCCGCTG
CAGGAGGGTCTCATGACGCTGACGTCCAAGATTGATGGAACTTACATGACGCAAAACGTGCTGGAGCTGGCCGAC
AACGTTGACGTGGACAAGCTGTGCGCGGCGTGGGAGCACGTGACTTGCGCTCTGCCGCTGCTACGTACCCGCATC
GTCCAGAACAGCGACCTCAGTCTCCAGCAGATTGTGCTCGACCAAAAGATATGCTGGACTCGTGCCACGGGCTTG
CAGAGCCATCTGGATGCTGATGGCCAACAGTCCATGCCTCTGGGGGAGCCCCTGGCCCGCTATGCCCTGGTGAGC
AACGAGACGGGCACAGTCAAATGGCTTGTGTGGACTGTGCATCACGCTCTCTACGACGGCTGGTCGATGCCTCTT
GTCATCGACGCCGTCTACCAGGCCTATGAGGGAAAGCGACTCGATGACGAGTTTCCCCCGTTTCAAGCCTTCATC
GAGTACATCAAGGGCCAAGACGAGCAGGCGCTTTCAAGCTACTGGCAGGACGCCCTAGCCGATTGCCAAAGCATC
CCCTTTCCAGCTCTGCCGCCATCTCTTGAGCAGCAGCTGGCTCCTACCAGCCATGTCGAGCACTCTTTGACACTG
CCCACCAGCAAGACTCCCAATGTGACGGCGTCGACGCTGATTAGGGCAGCCTGGGCGTTTGTCGTCGGCTGCATG
ACCGACTCGGACGATGTCGTTTTTGGAGCCACCGTGTCAGGGCGCAGCGCCCCCGTTGCTGGGCTGGATAGGATG
GCGGCGCCCACAATCGCCACTCTGCCTCTTCGGCTCCGAGTGCGCGGCAGCCAAACTGTTGCTGACTACCTCGCC
GCGGCTCAGCAGCAAGCAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNGACGCTGCTCGTCATCCAGCCCGAGGAATCCATAGTCGGTGCTGGGCCCTTGGGCTCCTGGCTCG
ATAGCTCGCAGCCTCAATGGATCGACACGTACGCTCTGACGCTGGAGCTGCGGCTCGGCGCCAAACGAGGTGCTG
CTTTAGCCATCTTTGACTCGAGGGTCATTTCTCCGTGGCTGGTCCAGACCTTGTTACAGAGGCTAGATTTTGTCG
TGCAGCAATTTAGCAACGCTAATCCCAGCCAAACACTGTCGAGTGTAGGCCTGATGACGCCGCAAGACTTGGAAT
CCATATGGCAGTGGAATGCCACAGTGCCTCTGCCTGCTACGCAAAGCGTTGCACAGATGATTGCTGAGCGTGTGC
AAGCTCAGCCCGATGCCCCGGCCGTGTGTGCCTGGGACGGCGAACTGACCTATAGCCAGCTAGACACTCTGGCCA
CAAGACTCGCTAACCTCCTTGTCGACCACGGAGTAGCAGCCCAGGTGCCCCTAGTGCCGCTCTGCTTTGAAAAGA
GCATGTGGACCACGGTGGCCATACTCGGCGTAGTCAAGGCCGGAGCCGCCTTTATTCTGCTTGATCCAGCACTCC
CCGAGCAACGCCTCAAATCCATCGTGCAACAAGTCAGGGCTAACCTCATCTTGACTTGTCCCTCTGCCCAAGCCT
TGAGCTCGCGCTTGGCAAATCAAACAATTACGCTGAGCTCGAGTCTGTTTGCCGATTTGCCAGACGGCGGGCGGC
AACACGTGCCGGCGTTGTCTCTATCTTCTCTCTTATACATCCTCTTCACCTCGGGGAGCACAGGCACGCCAAAGG
GCGTCAAGATAACTCACCTTAACGCTGCGTCTGCTCTGGTCCATCAAACACACCGTATTGGGTTCACGCCTGAAT
CCCGAGTCTTTGACTTTGCCTCGTATAGCTTTGATGTATCCATTAGCAACGTCTTTTCGACTTTGACGTCGGGTG
CCTGTCTTTGCGTTCCCAAAGACCAAGATCGGCAGACCAACCTGGAACAAAGCATAGCTTCTCTGCGCGCAAACG
TGCTCGACATAACTCCAACACTCGCTCACATATTGTCACCAGCCAACATCCCCTTGGTCAAGACAATCATCTTGA
GTGGCGAGGCATTCCGTGCTGCTGACGTGGAAAAGTGGTTGCGGGCCGAGGTTCGCCTTGTCAATGCTTACGGAC
CAAGCGAGTGCACCCCAACCGGCACACTCAACTGCAGCGCACGCACTCCACAAGCCGTCGTTTCCATCGGCAAAG
GCGTCGGTGTCGTGACATGGATAGTCAACCCGAACAGTCATGACCAACTCCTCCCACCTGGATCCGTCGGCGAAC
TGCTACTCGAGGGTCCCCTTGTTGGCAATGGTTATCTAGACGATCCTAAACGCACAGCCGCTGTCTTCATTGACG
ACCCATCGTGGCTATTGCAAGGAGCGCCAGGTCAACCAGGACGCCATGGGCGGCTCTACAAGACGGGAGATTTGG
TGCGATATAACCAAGATGGAAGCTTGGTCTTTATTGGGCGCAAAGACACGCAGACCAAGATTCGTGGACAGCGAG
TGGAGCTCGAGGAAATCGAGCATCACGTCTGTCGATGCGTACCAAGCGTGAGACAAGCCGTGGCTGAAGTTGTGA
CGCCCGATGACCAAGGAAGCCCAATGGTAGTCGTCTTTGTTGAGGTGGATGATGAAGCGAGGACAGAGGAACGGG
AGCGCACGGAGCCCAGCATAATGTCCATAACGCCACAGGTCGAAAGGCAGCTGGCAGATCATCTTACAAGTTACA
TGATGCCTGCCTTCTTCCTGTCCATGGCAGAGCTTCCCGTGACGCCAACAGGCAAGACGGATCACAAGAAACTAC
GTCAGACTGGTCGGGATTTCTTGGCTGCTGGGGCAAAATCCCCCTCACTCCAGCTTCTCGTCGGTGATGGCGAAA
CAATAACCAAGACTGAACAGCCCGCATATGCGCTTGCACAGAGCGTTTTTTCCATGCTGCCCTCGTGGCGTCGTC
AGTCTCTGTCAAGTCAAGACGCGTCTAGCTTCGAGAATGTCTTGCTGCAGCCTTGCGGCCTCGACTCCATCAACA
TGATGTCGCTTATTCGCCATGTCTTGCGCGAGTTTGGTGTCAAGCTCAGTTTGGAGCTTTTGTTGGACCGAACGA
CGAGCATCCGCACTTTGGCCAAATCAGTCTTGGATCTGCAAGACGCCCAAACGCAAACGTCGCAAGGGATGCTGC
CCACTCACTACTCACCAAGCGTTGATATTATGGCTCAGGTAGAAAAACATGATGCCACTGTTGCCGCTGTCCAGC
AGCAGGTGGCGTCTGCTGAAGCGTACACCAATGGCAACGACACAAATAGCCAAAAGCCGTTGACCGTCTTGCTGA
CGGGTGCCAACGGATTCATTGGCTCACAGATTTTGCGCCAGCTTCTGGAAAGCAAAACGATTGGCCAAGTGGTGG
CGGTGGTGCGCGGTGAGACTCGAGACGCCGCCAGAAAGCGCGCCATTAGTGCTGCCAAAACGGCGCTCTGGTGGA
CGGATGAGCACGCCGACAAGCTGCAAGTCTGGCCTGGAGACCTATCTCTGCCGCAGCTGGGGCTAGATGCAACGC
ACTGGGCACGCTTTGCCGACCAAGAGTGGTTTGACATTGTCATCCACAGCGGGGCCGAGGTGCACTGGGGCAAAA
ACTACGCAAGCCTCGAGGCCACCAATGTGAGCTCGACTGTGGAGCTGCTTCGTACCGTGGTGGCAGTCCCGGGAA
TGAAGTTTGTCTATGTCTCTGGTGGCAGAGATGGAGGAGCCGAGGATGAGGACGAGGAGCAAGTGGCACAAGAGC
TTGGAGCTCCCGGTGCCATTGGCTATAGCCAGACCAAGTTTGTTGCCGAGGCAGTTGTCAAGCGCGCAGCAAAGC
GCTGCGCCATGAGCCCGAGTCGTCTGGCCGTTGTGACGCCAGGCCTTGTTGTCGGGACGCCAACCGAGGGCGTGC
CCAATGCCGATGATTACATGTGGCGACTGGCGGCCTCGTGTATCCGGGTTGGCATGTACAATGCCGACGAGGCGG
ATGCCTGGCTTGCCCTATCCGACGTGGCGGCGCTTGCGGCCATTATTGTTGATTCAGCCTTGCATCCAGACGCCG
TGCCAGAGGCAAAACGCTATGTTAGGGATGGCATGAAGTGGCGTGACTTTTGGGCTATCCTGAGCGGCTTGGGCT
ACCAGTTGCAAGCCAAGCCGGTGACGCAGTGGCTAGCTGCTGTGCGAAAAGACATTGACGCCGTGGGCGAGACCC
ATCCACTATGGCCACTGAAGCATCTCGTTGAGGAGGAGAGTTTGATGCAAAACAATGAGACGAGTGACTCGAGCA
GCGAGGGCGAGACGCCGCACAGGTTGACTGTGGCGGTTGAGAAGAGCGCCCAGTTTCTTTGCAAATGCGGGTTTT
TTGAGCCGGTGCCTCTGGCTGATTGTCAGGGTGCGCCGCAAAGGGAGGTGGTGTCTTGCAAGCCCTTTACGCGGT
CCAAGAAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail