Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|634
Gene name
LocationContig_110:29399..30384
Strand+
Gene length (bp)985
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 9.6E-08 7 23
PF00098 zf-CCHC Zinc knuckle 2.4E-08 28 44
PF00098 zf-CCHC Zinc knuckle 3.8E-09 51 66
PF00098 zf-CCHC Zinc knuckle 1.6E-07 83 98
PF00098 zf-CCHC Zinc knuckle 1.1E-05 119 134
PF00098 zf-CCHC Zinc knuckle 2.0E-09 139 155
PF00098 zf-CCHC Zinc knuckle 3.2E-06 163 179
PF14392 zf-CCHC_4 Zinc knuckle 1.2E-02 5 22
PF14392 zf-CCHC_4 Zinc knuckle 1.8E+00 29 43
PF14392 zf-CCHC_4 Zinc knuckle 2.5E+00 52 66
PF14392 zf-CCHC_4 Zinc knuckle 3.3E-01 83 98
PF14392 zf-CCHC_4 Zinc knuckle 2.5E+00 120 134
PF14392 zf-CCHC_4 Zinc knuckle 3.4E-01 140 155
PF14392 zf-CCHC_4 Zinc knuckle 1.9E+00 162 178
PF13917 zf-CCHC_3 Zinc knuckle 5.2E-01 27 44
PF13917 zf-CCHC_3 Zinc knuckle 5.0E-02 49 67
PF13917 zf-CCHC_3 Zinc knuckle 2.2E-01 78 98
PF13917 zf-CCHC_3 Zinc knuckle 5.1E-01 116 136
PF13917 zf-CCHC_3 Zinc knuckle 4.3E-01 140 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 8 177 6.0E-38
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 7 179 3.0E-36
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 7 180 1.0E-33
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 3 178 3.0E-29
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 8 179 6.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 8 177 6.0E-38
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 7 179 3.0E-36
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 7 180 1.0E-33
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 3 178 3.0E-29
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 8 179 6.0E-29
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 3 159 2.0E-26
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 3 159 2.0E-26
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 3 159 2.0E-25
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 3 159 2.0E-25
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 3 159 2.0E-25
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 3 159 2.0E-25
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 3 178 5.0E-25
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 3 178 4.0E-23
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 3 178 3.0E-21
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 3 178 3.0E-21
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 3 178 3.0E-21
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 46 179 6.0E-21
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 1 134 2.0E-20
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 2 135 2.0E-18
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 2 135 2.0E-18
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 2 135 2.0E-18
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 2 135 3.0E-18
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 28 178 2.0E-17
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 3 99 9.0E-17
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 7 136 3.0E-16
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 6 156 3.0E-16
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 6 179 3.0E-16
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 7 99 4.0E-16
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 51 178 6.0E-15
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 52 180 6.0E-14
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 83 178 7.0E-14
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 22 178 8.0E-14
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 52 180 2.0E-13
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 49 180 2.0E-13
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 49 180 2.0E-13
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 49 180 2.0E-13
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 27 177 1.0E-12
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 25 127 2.0E-12
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 29 159 3.0E-12
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 21 165 2.0E-11
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 24 65 2.0E-11
sp|P27980|POL_SIVVG Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag-pol PE=3 SV=2 24 65 2.0E-11
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 80 179 3.0E-11
sp|Q79666|POL_HV1MV Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate MVP5180) GN=gag-pol PE=3 SV=3 22 135 3.0E-11
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 6 67 7.0E-11
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 7 70 2.0E-10
sp|P27973|POL_SIVV1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag-pol PE=3 SV=2 28 65 6.0E-10
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 5 68 7.0E-10
sp|O91080|POL_HV1YF Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF30) GN=gag-pol PE=3 SV=3 24 69 1.0E-09
sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag-pol PE=3 SV=3 24 65 1.0E-09
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 7 65 1.0E-09
sp|P24740|POL_HV1U4 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag-pol PE=1 SV=3 7 65 2.0E-09
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 7 66 2.0E-09
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 7 65 3.0E-09
sp|Q9QBZ5|POL_HV1MP Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag-pol PE=3 SV=3 7 65 3.0E-09
sp|P03367|POL_HV1BR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag-pol PE=1 SV=3 7 65 3.0E-09
sp|P0C6F2|POL_HV1LW Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag-pol PE=1 SV=1 7 65 4.0E-09
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 7 66 4.0E-09
sp|Q1A249|POL_SIVEK Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate EK505) GN=gag-pol PE=3 SV=3 24 65 4.0E-09
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 24 65 5.0E-09
sp|P20892|POL_HV1OY Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 7 65 5.0E-09
sp|P27978|GAG_SIVVG Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag PE=3 SV=1 24 65 5.0E-09
sp|P35963|POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag-pol PE=1 SV=3 7 65 6.0E-09
sp|P12497|POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 7 65 6.0E-09
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 7 65 6.0E-09
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 24 65 8.0E-09
sp|Q1A267|POL_SIVMB Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 24 65 8.0E-09
sp|Q9IDV9|POL_HV1YB Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag-pol PE=1 SV=3 24 69 8.0E-09
sp|Q9Q720|POL_HV1V9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag-pol PE=3 SV=3 24 65 9.0E-09
sp|Q9QBZ9|POL_HV197 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag-pol PE=3 SV=2 7 65 1.0E-08
sp|P20875|POL_HV1JR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 7 65 1.0E-08
sp|Q9QBY3|POL_HV196 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 24 65 1.0E-08
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 7 65 1.0E-08
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 29 154 1.0E-08
sp|Q9QSR3|POL_HV1VI Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 24 65 1.0E-08
sp|P03369|POL_HV1A2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 7 65 1.0E-08
sp|P03366|POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 7 65 1.0E-08
sp|P04585|POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag-pol PE=1 SV=4 7 65 1.0E-08
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 118 180 2.0E-08
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 24 65 2.0E-08
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 26 154 2.0E-08
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 4 79 3.0E-08
sp|O89940|POL_HV1SE Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 24 65 3.0E-08
sp|Q8N567|ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 19 151 3.0E-08
sp|P19505|POL_SIVSP Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 7 66 3.0E-08
sp|P18802|POL_HV1ND Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag-pol PE=3 SV=3 7 65 3.0E-08
sp|P04588|POL_HV1MA Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 28 65 3.0E-08
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 3 97 4.0E-08
sp|P05961|POL_HV1MN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag-pol PE=1 SV=3 7 65 4.0E-08
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 7 65 4.0E-08
sp|Q9WC54|POL_HV1S2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 7 65 4.0E-08
sp|P05960|POL_HV1C4 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag-pol PE=3 SV=3 7 65 4.0E-08
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 24 65 4.0E-08
sp|P17283|POL_SIVCZ Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 28 65 5.0E-08
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 24 73 5.0E-08
sp|P20876|POL_HV2ST Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 24 87 5.0E-08
sp|P15833|POL_HV2D2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate D205) GN=gag-pol PE=3 SV=3 24 66 6.0E-08
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 28 67 7.0E-08
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 28 66 7.0E-08
sp|P12499|POL_HV1Z2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 24 65 8.0E-08
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 24 69 8.0E-08
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 24 65 9.0E-08
sp|Q8R1J3|ZCHC9_MOUSE Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 19 151 9.0E-08
sp|O41798|POL_HV19N Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag-pol PE=3 SV=3 24 65 1.0E-07
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 120 180 2.0E-07
sp|P05892|GAG_SIVVT Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag PE=3 SV=1 23 65 2.0E-07
sp|P27972|GAG_SIVV1 Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag PE=3 SV=1 28 65 2.0E-07
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 24 79 2.0E-07
sp|P05896|POL_SIVM1 Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate Mm142-83) GN=gag-pol PE=1 SV=2 24 66 2.0E-07
sp|P05897|POL_SIVMK Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate K6W) GN=gag-pol PE=1 SV=2 24 66 2.0E-07
sp|Q89928|POL_HV2EH Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate EHO) GN=gag-pol PE=3 SV=3 7 66 3.0E-07
sp|Q74120|POL_HV2KR Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 24 66 3.0E-07
sp|P18042|POL_HV2G1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 7 66 3.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 7 96 4.0E-07
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 7 66 4.0E-07
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 24 66 4.0E-07
sp|Q79665|GAG_HV1MV Gag polyprotein OS=Human immunodeficiency virus type 1 group O (isolate MVP5180) GN=gag PE=3 SV=3 24 79 4.0E-07
sp|P12502|POL_SIVS4 Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate F236/smH4) GN=gag-pol PE=3 SV=2 24 66 6.0E-07
sp|Q1A268|GAG_SIVMB Gag polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag PE=3 SV=3 27 82 6.0E-07
sp|Q77372|GAG_HV1AN Gag polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag PE=3 SV=3 24 79 6.0E-07
sp|Q8N567|ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 2 68 9.0E-07
sp|Q76634|POL_HV2UC Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate UC1) GN=gag-pol PE=3 SV=3 24 66 9.0E-07
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 49 179 1.0E-06
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 138 179 1.0E-06
sp|Q9QBZ2|GAG_HV1M2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag PE=3 SV=2 23 80 1.0E-06
sp|Q02843|GAG_SIVG1 Gag polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag PE=1 SV=1 24 65 1.0E-06
sp|P04593|GAG_HV1B5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag PE=3 SV=3 24 98 1.0E-06
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 137 179 2.0E-06
sp|Q8R1J3|ZCHC9_MOUSE Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 2 65 2.0E-06
sp|Q70622|GAG_HV1LW Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag PE=1 SV=3 24 98 2.0E-06
sp|P03348|GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag PE=1 SV=3 24 98 2.0E-06
sp|O93182|GAG_HV190 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag PE=3 SV=3 23 82 2.0E-06
sp|Q9IDV8|GAG_HV1YB Gag polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag PE=3 SV=3 24 80 2.0E-06
sp|P05962|POL_HV2NZ Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate NIH-Z) GN=gag-pol PE=3 SV=3 24 66 2.0E-06
sp|Q9QBY4|GAG_HV196 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag PE=3 SV=2 24 80 2.0E-06
sp|P15833|POL_HV2D2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate D205) GN=gag-pol PE=3 SV=3 105 163 3.0E-06
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 111 157 3.0E-06
sp|Q9QSR4|GAG_HV1VI Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag PE=3 SV=3 24 80 3.0E-06
sp|P05887|GAG_HV1C4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag PE=3 SV=3 27 80 3.0E-06
sp|Q1A250|GAG_SIVEK Gag polyprotein OS=Simian immunodeficiency virus (isolate EK505) GN=gag PE=3 SV=3 24 65 4.0E-06
sp|O91079|GAG_HV1YF Gag polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF30) GN=gag PE=3 SV=3 24 80 4.0E-06
sp|Q8AII2|GAG_SIVTN Gag polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag PE=3 SV=3 24 86 4.0E-06
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 29 66 5.0E-06
sp|Q73367|GAG_HV1B9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag PE=3 SV=3 24 80 5.0E-06
sp|P35962|GAG_HV1Y2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag PE=1 SV=2 24 80 5.0E-06
sp|Q9QBZ6|GAG_HV1MP Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 27 80 5.0E-06
sp|P24106|GAG_HV2CA Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag PE=3 SV=3 23 89 5.0E-06
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 3 67 6.0E-06
sp|P12493|GAG_HV1N5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag PE=1 SV=3 24 80 6.0E-06
sp|O89939|GAG_HV1SE Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag PE=3 SV=3 24 80 6.0E-06
sp|P19560|POL_BIV29 Gag-Pol polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag-pol PE=1 SV=2 113 153 6.0E-06
sp|P69732|GAG_EIAVY Gag polyprotein OS=Equine infectious anemia virus (strain Wyoming) GN=gag PE=1 SV=1 22 84 6.0E-06
sp|P69731|GAG_EIAVC Gag polyprotein OS=Equine infectious anemia virus (isolate CL22) GN=gag PE=3 SV=1 22 84 6.0E-06
sp|P69730|GAG_EIAV9 Gag polyprotein OS=Equine infectious anemia virus (isolate 1369) GN=gag PE=1 SV=1 22 84 6.0E-06
sp|Q9Q721|GAG_HV1V9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag PE=3 SV=3 24 82 6.0E-06
sp|P20889|GAG_HV1OY Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag PE=3 SV=3 24 80 6.0E-06
sp|P04590|GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag PE=1 SV=3 23 89 7.0E-06
sp|P20873|GAG_HV1JR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag PE=3 SV=3 24 98 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|634
MDLPRGACYACGSTGHQARDCPSRGPAKCYNCGGEGHISRECPEPLKDNKSCYKCGQPGHISRDCPTSGGAGGAG
GNGPSTECYKCGEIGHIARSCPKSSFGGAPYGGGNFAAGGGAGKTCYSCGGYGHMSRECVNGMKCYNCGETGHFS
RECPKESTGGERICYKCQQPGHVQAQCPNN*
Coding >OphauB2|634
ATGGATTTGCCTCGTGGCGCATGCTATGCCTGCGGCTCCACTGGCCATCAGGCTCGTGACTGTCCGTCCCGTGGC
CCTGCTAAGTGCTACAACTGTGGCGGCGAGGGCCACATCAGCCGAGAATGCCCTGAGCCACTCAAAGACAACAAG
TCGTGTTACAAATGCGGACAGCCAGGACATATTTCTCGTGATTGTCCCACCAGCGGTGGTGCCGGTGGTGCTGGA
GGCAACGGGCCATCAACTGAATGCTACAAGTGCGGAGAAATTGGACATATTGCCCGCAGCTGTCCTAAATCTTCA
TTCGGTGGTGCGCCGTACGGAGGCGGCAATTTTGCAGCCGGTGGGGGCGCTGGCAAGACTTGCTATTCTTGCGGA
GGATACGGCCACATGTCGCGTGAGTGCGTCAACGGCATGAAGTGCTACAATTGTGGTGAGACGGGCCACTTCTCC
AGAGAGTGCCCCAAGGAATCGACTGGAGGCGAAAGGATCTGTTACAAATGCCAACAACCTGGACACGTGCAGGCT
CAGTGCCCCAATAACTAA
Transcript >OphauB2|634
ATGGATTTGCCTCGTGGCGCATGCTATGCCTGCGGCTCCACTGGCCATCAGGCTCGTGACTGTCCGTCCCGTGGC
CCTGCTAAGTGCTACAACTGTGGCGGCGAGGGCCACATCAGCCGAGAATGCCCTGAGCCACTCAAAGACAACAAG
TCGTGTTACAAATGCGGACAGCCAGGACATATTTCTCGTGATTGTCCCACCAGCGGTGGTGCCGGTGGTGCTGGA
GGCAACGGGCCATCAACTGAATGCTACAAGTGCGGAGAAATTGGACATATTGCCCGCAGCTGTCCTAAATCTTCA
TTCGGTGGTGCGCCGTACGGAGGCGGCAATTTTGCAGCCGGTGGGGGCGCTGGCAAGACTTGCTATTCTTGCGGA
GGATACGGCCACATGTCGCGTGAGTGCGTCAACGGCATGAAGTGCTACAATTGTGGTGAGACGGGCCACTTCTCC
AGAGAGTGCCCCAAGGAATCGACTGGAGGCGAAAGGATCTGTTACAAATGCCAACAACCTGGACACGTGCAGGCT
CAGTGCCCCAATAACTAA
Gene >OphauB2|634
ATGGATTTGCCTCGTGGCGCATGCTATGCCTGTGAGTCCCCTTCTGAATGCCTTCTGTCGTGACTCGACATTTTC
TCTCAGCCTCGCTAATAAGCTTTGCGCAGGCGGCTCCACTGGCCATCAGGTACGGCAAGCGATATCGTGTGCTAG
AAGTCTCGCCTAACAACTGCTATTCTAGGCTCGTGACTGTCCGTCCCGTGGCCCTGCTAAGTGGTGAGTTCACAT
GGACTCTGTAATGTACTCTGGAATATTTGGAATTGACGGAATATTTTAGCTACAACTGTGGCGGTATGTTCCAAG
ATTGCACTGCCTCGTGCTCGCAGACATGCTAATTACAGATGCGTTGCTTCAGGCGAGGGCCACATCAGTGAGTAT
CCAATCCCCGGCCTATATCATACTTTTGGCTCACAAGACTTCTTCCTCTAGGCCGAGAATGCCCTGAGCCACTCA
AAGACAACAAGTCGTGTTACAAATGCGGACAGCCAGGACATATTTCTCGTGATTGTCCCACCAGCGGTGGTGCCG
GTGGTGCTGGAGGCAACGGGCCATCAACTGAATGCTACAAGGTAAATCTGGGTTCTTCGTTGCACTATGTTAGCA
CCAGTATCAGCACCAGTGTTGGCTAACGCGAATAATAAGTGCGGAGAAATTGGACATATTGCCCGCAGCTGTCCT
AAATCTTCATTCGGTGGTGCGCCGTACGGAGGCGGCAATTTTGCAGCCGGTGGGGGCGCTGGCAAGACTTGCTAT
TCTTGCGGAGGATACGGCCACATGTCGCGTAAGGAAGAGCCCTTTTGCTTCGACTTTTTTTTTCTGAGATACTAA
CCATGATACAGGTGAGTGCGTCAACGGCATGAAGTGCTACAATTGTGGTGAGACGGGCCACTTCTCCAGAGAGTG
CCCCAAGGAATCGACTGGAGGCGAAAGGATCTGTTACAAATGCCAACAACCTGGACACGTGCAGGCTCAGTGCCC
CAATAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail