Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6338
Gene name
LocationContig_57:97582..99423
Strand-
Gene length (bp)1841
Transcript length (bp)1659
Coding sequence length (bp)1659
Protein length (aa) 553

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 1.9E-44 70 517
PF00324 AA_permease Amino acid permease 1.7E-24 87 527

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 39 527 3.0E-73
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 47 515 2.0E-61
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 33 545 7.0E-54
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 1 541 3.0E-49
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 53 541 5.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 39 527 3.0E-73
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 47 515 2.0E-61
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 33 545 7.0E-54
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 1 541 3.0E-49
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 53 541 5.0E-48
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 32 552 4.0E-46
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 22 551 1.0E-44
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 33 550 5.0E-40
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 41 548 4.0E-38
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 39 551 2.0E-37
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 38 541 7.0E-35
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 50 541 2.0E-33
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 41 516 1.0E-31
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 33 526 5.0E-26
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 47 552 2.0E-10
sp|O07576|YHDG_BACSU Uncharacterized amino acid permease YhdG OS=Bacillus subtilis (strain 168) GN=yhdG PE=2 SV=1 50 448 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 114 136 22
3 157 179 22
4 189 211 22
5 223 245 22
6 272 289 17
7 310 332 22
8 360 382 22
9 408 430 22
10 434 456 22
11 481 503 22
12 508 530 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6338
MSKMLTSSRVKAFRGLRGNGWERKGHRLLDAPDEALRSERDASQVISRDDELLATLGYKRELNRGLGLFENWAAT
FSCMNFVSGMPVLFGWVMMTGGPQAAITSWTVVSTVSCLLALAMAEIAAALPTAGGIYYWAYRLGGSEWGPFLSW
MTAWWNWSAWILAVPGTQQGATNFLVSALQINYPDADFVSQSWFSLVVILLGLVIALIPNITNQSLLRIYFRFAI
GIFLILFFLFWIWFPIAVAGRFQSPSFVFQTFHNGINHGPTQQASNAYCWAISFLFGAWEFGGYDASAHLAEETK
DASKTVARGMYLSTLSTTLLSIPTLILILFCIQDFDALISATYANNWAEFLVQVVGPRGATAILLLSWIDCTCAT
AAVILSAQRVTFAISRDNILPGSHLFRRVSGNNAAPVNAALLVVAIAALVSLTVLGSSVAFSAITATTVICQSMS
YLFVLFTRYTFGKTTFEPAAWNLGFLSRPIGYLSILWLTFLSCILLLPQVFPVTMRTLNYAPICLIIVTAVSFIG
WLLPFGMGGRHWFKGPCNTVAAQPEET*
Coding >OphauB2|6338
ATGTCCAAGATGTTGACTTCGTCTCGCGTCAAGGCGTTTCGTGGCTTGAGGGGCAACGGGTGGGAGCGCAAGGGC
CACCGGCTGCTGGATGCGCCAGACGAGGCGCTGCGGTCGGAGCGAGATGCTTCGCAGGTGATTTCTCGCGATGAC
GAGCTGCTGGCTACGCTGGGCTACAAGCGAGAGTTGAACCGCGGCCTGGGACTGTTTGAGAATTGGGCGGCTACG
TTTTCGTGTATGAACTTCGTCTCGGGAATGCCCGTCTTGTTTGGCTGGGTCATGATGACTGGCGGGCCCCAAGCT
GCCATTACCTCGTGGACCGTTGTCAGTACCGTCTCGTGCTTGCTTGCCTTGGCCATGGCTGAGATTGCCGCCGCC
CTGCCAACGGCTGGGGGCATCTACTACTGGGCCTATCGCCTAGGAGGCTCGGAATGGGGTCCCTTTCTGTCCTGG
ATGACGGCATGGTGGAACTGGTCGGCTTGGATCCTGGCTGTCCCCGGCACGCAGCAAGGCGCCACAAACTTTCTC
GTTTCCGCTCTTCAAATAAACTACCCCGATGCCGATTTCGTCAGCCAGAGCTGGTTCTCCTTGGTCGTTATCCTT
CTCGGACTCGTCATTGCCCTGATTCCAAACATTACCAACCAAAGCTTGCTACGCATATATTTCCGCTTTGCCATT
GGCATCTTCTTGATTCTCTTTTTCCTTTTCTGGATCTGGTTTCCCATTGCCGTGGCTGGCCGATTTCAGTCCCCG
AGCTTCGTCTTCCAGACCTTCCACAACGGCATCAACCACGGCCCGACGCAACAGGCTTCAAATGCATACTGCTGG
GCCATTAGCTTTCTCTTTGGCGCTTGGGAGTTTGGCGGCTACGATGCCTCGGCCCATTTGGCAGAGGAGACCAAG
GACGCCAGCAAAACCGTGGCCCGAGGAATGTATCTCTCCACTCTCTCCACCACGCTTCTTTCCATTCCTACCCTC
ATCTTGATTCTCTTTTGCATTCAGGACTTTGATGCCCTCATTTCTGCTACTTATGCCAACAACTGGGCCGAGTTT
CTTGTTCAAGTCGTTGGCCCTCGCGGCGCCACCGCCATTTTGCTCCTTAGCTGGATCGACTGCACTTGCGCTACT
GCTGCCGTTATTCTGTCTGCTCAGCGCGTCACTTTTGCCATTTCGCGCGACAACATTTTGCCCGGGTCGCACTTG
TTTAGAAGAGTAAGCGGGAACAATGCCGCGCCAGTCAATGCTGCCTTGTTGGTCGTCGCCATTGCCGCCCTTGTC
AGCCTTACTGTGCTTGGATCCTCAGTCGCCTTTAGTGCCATTACGGCAACGACTGTCATTTGCCAAAGCATGAGC
TATCTGTTTGTCCTCTTCACTCGATACACCTTTGGCAAAACTACCTTTGAGCCGGCTGCATGGAATCTTGGCTTC
CTGTCGCGCCCGATAGGATACCTTTCCATACTCTGGCTCACCTTTCTTTCATGTATTCTGCTACTGCCCCAGGTT
TTCCCCGTGACTATGCGCACGCTAAACTATGCTCCGATCTGTCTTATTATTGTAACGGCTGTGTCTTTTATTGGG
TGGCTTCTTCCTTTTGGAATGGGGGGGCGGCACTGGTTCAAAGGTCCATGCAATACGGTGGCGGCGCAGCCCGAG
GAGACGTGA
Transcript >OphauB2|6338
ATGTCCAAGATGTTGACTTCGTCTCGCGTCAAGGCGTTTCGTGGCTTGAGGGGCAACGGGTGGGAGCGCAAGGGC
CACCGGCTGCTGGATGCGCCAGACGAGGCGCTGCGGTCGGAGCGAGATGCTTCGCAGGTGATTTCTCGCGATGAC
GAGCTGCTGGCTACGCTGGGCTACAAGCGAGAGTTGAACCGCGGCCTGGGACTGTTTGAGAATTGGGCGGCTACG
TTTTCGTGTATGAACTTCGTCTCGGGAATGCCCGTCTTGTTTGGCTGGGTCATGATGACTGGCGGGCCCCAAGCT
GCCATTACCTCGTGGACCGTTGTCAGTACCGTCTCGTGCTTGCTTGCCTTGGCCATGGCTGAGATTGCCGCCGCC
CTGCCAACGGCTGGGGGCATCTACTACTGGGCCTATCGCCTAGGAGGCTCGGAATGGGGTCCCTTTCTGTCCTGG
ATGACGGCATGGTGGAACTGGTCGGCTTGGATCCTGGCTGTCCCCGGCACGCAGCAAGGCGCCACAAACTTTCTC
GTTTCCGCTCTTCAAATAAACTACCCCGATGCCGATTTCGTCAGCCAGAGCTGGTTCTCCTTGGTCGTTATCCTT
CTCGGACTCGTCATTGCCCTGATTCCAAACATTACCAACCAAAGCTTGCTACGCATATATTTCCGCTTTGCCATT
GGCATCTTCTTGATTCTCTTTTTCCTTTTCTGGATCTGGTTTCCCATTGCCGTGGCTGGCCGATTTCAGTCCCCG
AGCTTCGTCTTCCAGACCTTCCACAACGGCATCAACCACGGCCCGACGCAACAGGCTTCAAATGCATACTGCTGG
GCCATTAGCTTTCTCTTTGGCGCTTGGGAGTTTGGCGGCTACGATGCCTCGGCCCATTTGGCAGAGGAGACCAAG
GACGCCAGCAAAACCGTGGCCCGAGGAATGTATCTCTCCACTCTCTCCACCACGCTTCTTTCCATTCCTACCCTC
ATCTTGATTCTCTTTTGCATTCAGGACTTTGATGCCCTCATTTCTGCTACTTATGCCAACAACTGGGCCGAGTTT
CTTGTTCAAGTCGTTGGCCCTCGCGGCGCCACCGCCATTTTGCTCCTTAGCTGGATCGACTGCACTTGCGCTACT
GCTGCCGTTATTCTGTCTGCTCAGCGCGTCACTTTTGCCATTTCGCGCGACAACATTTTGCCCGGGTCGCACTTG
TTTAGAAGAGTAAGCGGGAACAATGCCGCGCCAGTCAATGCTGCCTTGTTGGTCGTCGCCATTGCCGCCCTTGTC
AGCCTTACTGTGCTTGGATCCTCAGTCGCCTTTAGTGCCATTACGGCAACGACTGTCATTTGCCAAAGCATGAGC
TATCTGTTTGTCCTCTTCACTCGATACACCTTTGGCAAAACTACCTTTGAGCCGGCTGCATGGAATCTTGGCTTC
CTGTCGCGCCCGATAGGATACCTTTCCATACTCTGGCTCACCTTTCTTTCATGTATTCTGCTACTGCCCCAGGTT
TTCCCCGTGACTATGCGCACGCTAAACTATGCTCCGATCTGTCTTATTATTGTAACGGCTGTGTCTTTTATTGGG
TGGCTTCTTCCTTTTGGAATGGGGGGGCGGCACTGGTTCAAAGGTCCATGCAATACGGTGGCGGCGCAGCCCGAG
GAGACGTGA
Gene >OphauB2|6338
ATGTCCAAGATGTTGACTTCGTCTCGCGTCAAGGCGTTTCGTGGCTTGAGGGGCAACGGGTGGGAGCGCAAGGGC
CACCGGCTGCTGGATGCGCCAGACGAGGCGCTGCGGTCGGAGCGAGATGCTTCGCAGGTGATTTCTCGCGATGAC
GAGCTGCTGGCTACGCTGGGCTACAAGCGAGGTAGCATTGGCCTCATGGACGGTCGAGGTTGACGCAACTGACGG
AATCCTTGGTAGAGTTGAACCGCGGCCTGGGACTGTTTGAGAATTGGGCGGCTACGTTTTCGGTTGGCTTCCTTG
GCCATGGCCCCCCCCCCTGGAGATGGGCGCACAAGCTAATACGACGCAGTGTATGAACTTCGTCTCGGGAATGCC
CGTCTTGTTTGGCTGGGTCATGATGACTGGCGGGCCCCAAGCTGCCATTACCTCGTGGACCGTTGTCAGTACCGT
CTCGTGCTTGCTTGCCTTGGCCATGGCTGAGATTGCCGCCGCCCTGCCAACGGCTGGGGGCATCTACTACTGGGC
CTATCGCCTAGGAGGCTCGGAATGGGGTCCCTTTCTGTCCTGGATGACGGCAGTAGGCGCCTTTGCCCCTACCTT
GAGTACTCCCATGTCGTGCTCGCTCTGACGCCTTTTTGCAGTGGTGGAACTGGTCGGCTTGGATCCTGGCTGTCC
CCGGCACGCAGCAAGGCGCCACAAACTTTCTCGTTTCCGCTCTTCAAATAAACTACCCCGATGCCGATTTCGTCA
GCCAGAGCTGGTTCTCCTTGGTCGTTATCCTTCTCGGACTCGTCATTGCCCTGATTCCAAACATTACCAACCAAA
GCTTGCTACGCATATATTTCCGCTTTGCCATTGGCATCTTCTTGATTCTCTTTTTCCTTTTCTGGATCTGGTTTC
CCATTGCCGTGGCTGGCCGATTTCAGTCCCCGAGCTTCGTCTTCCAGACCTTCCACAACGGCATCAACCACGGCC
CGACGCAACAGGCTTCAAATGCATACTGCTGGGCCATTAGCTTTCTCTTTGGCGCTTGGGAGTTTGGCGGCTACG
ATGCCTCGGCCCATTTGGCAGAGGAGACCAAGGACGCCAGCAAAACCGTGGCCCGAGGAATGTATCTCTCCACTC
TCTCCACCACGCTTCTTTCCATTCCTACCCTCATCTTGATTCTCTTTTGCATTCAGGACTTTGATGCCCTCATTT
CTGCTACTTATGCCAACAACTGGGCCGAGTTTCTTGTTCAAGTCGTTGGCCCTCGCGGCGCCACCGCCATTTTGC
TCCTTAGCTGGATCGACTGCACTTGCGCTACTGCTGCCGTTATTCTGTCTGCTCAGCGCGTCACTTTTGCCATTT
CGCGCGACAACATTTTGCCCGGGTCGCACTTGTTTAGAAGAGTAAGCGGGAACAATGCCGCGCCAGTCAATGCTG
CCTTGTTGGTCGTCGCCATTGCCGCCCTTGTCAGCCTTACTGTGCTTGGATCCTCAGTCGCCTTTAGTGCCATTA
CGGCAACGACTGTCATTTGCCAAAGCATGAGCTATCTGTTTGTCCTCTTCACTCGATACACCTTTGGCAAAACTA
CCTTTGAGCCGGCTGCATGGAATCTTGGCTTCCTGTCGCGCCCGATAGGATACCTTTCCATACTCTGGCTCACCT
TTCTTTCATGTATTCTGCTACTGCCCCAGGTTTTCCCCGTGACTATGCGCACGCTAAACTATGCTCCGATCTGTC
TTATTATTGTAACGGCTGTGTCTTTTATTGGGTGGCTTCTTCCTTTTGGAATGGGGGGGCGGCACTGGTTCAAAG
GTCCATGCAATACGGTGGCGGCGCAGCCCGAGGAGACGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail