Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6334
Gene name
LocationContig_57:85913..88275
Strand+
Gene length (bp)2362
Transcript length (bp)1962
Coding sequence length (bp)1962
Protein length (aa) 654

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 3.8E-44 409 651

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P84285|ARE2_CANAX Sterol O-acyltransferase 2 OS=Candida albicans GN=ARE2 PE=1 SV=1 94 653 2.0E-107
sp|Q10269|AREH1_SCHPO Probable sterol O-acyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=are1 PE=3 SV=1 123 653 3.0E-90
sp|P53629|ARE2_YEAST Sterol O-acyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARE2 PE=1 SV=1 406 651 1.0E-78
sp|Q876L2|ARE2_SACU7 Sterol O-acyltransferase 2 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=ARE2 PE=3 SV=1 406 651 1.0E-77
sp|Q9UU82|AREH2_SCHPO Probable sterol O-acyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=are2 PE=1 SV=1 156 636 3.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P84285|ARE2_CANAX Sterol O-acyltransferase 2 OS=Candida albicans GN=ARE2 PE=1 SV=1 94 653 2.0E-107
sp|Q10269|AREH1_SCHPO Probable sterol O-acyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=are1 PE=3 SV=1 123 653 3.0E-90
sp|P53629|ARE2_YEAST Sterol O-acyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARE2 PE=1 SV=1 406 651 1.0E-78
sp|Q876L2|ARE2_SACU7 Sterol O-acyltransferase 2 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=ARE2 PE=3 SV=1 406 651 1.0E-77
sp|Q9UU82|AREH2_SCHPO Probable sterol O-acyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=are2 PE=1 SV=1 156 636 3.0E-67
sp|P25628|ARE1_YEAST Sterol O-acyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARE1 PE=1 SV=1 395 653 4.0E-65
sp|Q876L3|ARE1_SACU7 Sterol O-acyltransferase 1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=ARE1 PE=3 SV=1 395 653 7.0E-63
sp|Q55BH9|DGAT1_DICDI Diacylglycerol O-acyltransferase 1 OS=Dictyostelium discoideum GN=dgat1 PE=3 SV=2 407 650 6.0E-31
sp|Q9ERM3|DGAT1_RAT Diacylglycerol O-acyltransferase 1 OS=Rattus norvegicus GN=Dgat1 PE=2 SV=1 387 651 5.0E-23
sp|Q9SLD2|DGAT1_ARATH Diacylglycerol O-acyltransferase 1 OS=Arabidopsis thaliana GN=DGAT1 PE=1 SV=2 392 636 1.0E-22
sp|Q9Z2A7|DGAT1_MOUSE Diacylglycerol O-acyltransferase 1 OS=Mus musculus GN=Dgat1 PE=1 SV=1 387 632 2.0E-22
sp|Q9GMF1|DGAT1_CHLAE Diacylglycerol O-acyltransferase 1 OS=Chlorocebus aethiops GN=DGAT1 PE=2 SV=1 412 632 9.0E-21
sp|O75907|DGAT1_HUMAN Diacylglycerol O-acyltransferase 1 OS=Homo sapiens GN=DGAT1 PE=1 SV=2 412 632 1.0E-20
sp|Q8MK44|DGAT1_BOVIN Diacylglycerol O-acyltransferase 1 OS=Bos taurus GN=DGAT1 PE=2 SV=2 403 632 5.0E-18
sp|Q61263|SOAT1_MOUSE Sterol O-acyltransferase 1 OS=Mus musculus GN=Soat1 PE=1 SV=2 417 650 4.0E-17
sp|Q60457|SOAT1_CRIGR Sterol O-acyltransferase 1 OS=Cricetulus griseus GN=SOAT1 PE=2 SV=1 417 650 1.0E-16
sp|P35610|SOAT1_HUMAN Sterol O-acyltransferase 1 OS=Homo sapiens GN=SOAT1 PE=1 SV=3 417 650 7.0E-16
sp|O77760|SOAT1_CHLAE Sterol O-acyltransferase 1 OS=Chlorocebus aethiops GN=SOAT1 PE=2 SV=1 417 650 8.0E-16
sp|O77761|SOAT1_MACFA Sterol O-acyltransferase 1 OS=Macaca fascicularis GN=SOAT1 PE=2 SV=1 417 650 8.0E-16
sp|O70536|SOAT1_RAT Sterol O-acyltransferase 1 OS=Rattus norvegicus GN=Soat1 PE=2 SV=1 417 642 4.0E-15
sp|O75908|SOAT2_HUMAN Sterol O-acyltransferase 2 OS=Homo sapiens GN=SOAT2 PE=2 SV=1 373 650 1.0E-14
sp|O77759|SOAT2_CHLAE Sterol O-acyltransferase 2 OS=Chlorocebus aethiops GN=SOAT2 PE=2 SV=1 373 650 3.0E-14
sp|O88908|SOAT2_MOUSE Sterol O-acyltransferase 2 OS=Mus musculus GN=Soat2 PE=1 SV=2 420 593 4.0E-14
sp|Q7TQM4|SOAT2_RAT Sterol O-acyltransferase 2 OS=Rattus norvegicus GN=Soat2 PE=2 SV=1 420 593 4.0E-14
sp|Q876L2|ARE2_SACU7 Sterol O-acyltransferase 2 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=ARE2 PE=3 SV=1 163 298 4.0E-11
sp|P53629|ARE2_YEAST Sterol O-acyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARE2 PE=1 SV=1 163 298 4.0E-10
sp|P25628|ARE1_YEAST Sterol O-acyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARE1 PE=1 SV=1 164 326 1.0E-08
sp|Q876L3|ARE1_SACU7 Sterol O-acyltransferase 1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=ARE1 PE=3 SV=1 164 322 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 451 473 22
2 494 516 22
3 576 598 22
4 630 652 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6334
MDPVNGAPAEHRPVSAASNGHSLGNGGPRSSRALAEVLRETGASLESSCNGSDTQSEEDYDENVRPAYSTGHQRQ
QHQPRARFSNAFPQEQPAKQAQTNMAIVRDATGTHIIPEDDGSIQELLLRSSRHFHDPKAPKRKGRFSDLVFTHQ
YSTFDSNNIAASSSPFHGFYTLFWLAISLMILKIFASNWRDYGTPLGSNEIMHIMFSRDVAVMLLSDGVMCGLGG
VSWALQKLVFARYIDWDRSGWILQNIWQTVFFTGVVGWTLVRDWPWTHTVFFVLHGLVMLMKQHSYAFYNGYLST
VYHKRLFLLSRLKQLELVAPATGPSTTAPSASTISVSHLDAPPSAEQRRLSLSHSPSNSTEETDIDRIARAISTR
QPLDDEQIDLFERIIKWEVDALADELRGTASDPCKFYPNNLTLLNYYKWIPLPTVVYELDYPRCEKVRWQYVAEK
SIAMVGIIFVMIQVSQYFIYPVVMKTIAMKENGLTLTERFREFPWMLLDLIFPFMMEYLLVWYLIWETILNILAE
LTGFADRSFYGPWWNSVSWDQFARDWNTPVHVFLLRHVYHSSISSMKVNKHTATLITFFFSACIHELVMWCLFKK
LRGYLLFFQMCQLPLVRLSRTRWLKGRKTLGNLMFWAGIFLCPSLLCSLYLIL*
Coding >OphauB2|6334
ATGGACCCTGTTAACGGTGCGCCTGCCGAGCACCGGCCGGTAAGCGCTGCATCCAACGGTCACTCTCTCGGCAAT
GGTGGGCCCCGCTCATCAAGAGCGCTGGCAGAAGTGCTCCGCGAGACTGGCGCCTCATTGGAATCTTCCTGCAAC
GGGTCTGATACGCAGAGCGAGGAAGACTATGATGAGAATGTCCGCCCAGCGTACTCGACTGGCCACCAGCGCCAG
CAGCACCAGCCCCGCGCTAGATTTTCAAATGCTTTTCCTCAGGAGCAGCCCGCCAAGCAAGCCCAGACTAACATG
GCCATTGTCCGAGATGCCACTGGGACCCATATTATTCCCGAAGACGATGGGAGCATCCAGGAACTGCTTTTGCGA
AGCTCACGGCATTTCCACGACCCCAAAGCACCCAAAAGAAAGGGACGCTTTAGTGACCTCGTCTTTACTCACCAG
TACTCTACCTTTGACTCCAACAACATTGCTGCATCAAGCAGCCCATTCCATGGCTTCTACACCCTCTTCTGGCTC
GCCATTTCACTCATGATTCTCAAAATCTTTGCCAGCAATTGGCGCGACTATGGCACGCCTCTGGGATCCAATGAA
ATTATGCACATCATGTTTTCCCGAGATGTTGCTGTTATGTTGCTCTCCGATGGCGTCATGTGTGGTCTGGGAGGA
GTAAGCTGGGCCTTGCAGAAACTCGTCTTTGCCAGGTATATCGACTGGGACCGCTCAGGGTGGATTCTCCAAAAC
ATTTGGCAGACAGTCTTCTTCACCGGCGTTGTAGGCTGGACGCTGGTGCGCGACTGGCCTTGGACACATACCGTC
TTCTTTGTCTTGCACGGCCTCGTAATGCTCATGAAGCAGCACTCGTATGCTTTTTACAATGGCTATCTCTCCACC
GTGTACCACAAGCGCCTCTTTCTGCTCTCAAGGCTCAAGCAGCTTGAATTGGTGGCACCGGCCACTGGGCCTTCA
ACGACGGCACCATCGGCCTCGACAATCAGCGTCTCGCATCTCGATGCGCCGCCGTCGGCTGAACAGCGCCGTCTC
TCCCTCTCACACTCGCCCTCCAACTCGACCGAGGAAACTGACATTGACCGCATCGCGCGTGCCATTTCCACGAGG
CAGCCACTAGATGACGAGCAAATTGATCTATTTGAGCGCATCATCAAGTGGGAGGTGGATGCTCTGGCCGATGAG
TTGCGCGGCACGGCTAGTGACCCGTGCAAGTTTTACCCCAATAACCTTACCCTGCTCAACTATTACAAGTGGATT
CCGTTACCGACTGTTGTCTACGAACTCGACTATCCGCGATGTGAAAAGGTACGTTGGCAGTATGTTGCCGAAAAG
AGCATTGCCATGGTGGGCATCATATTCGTCATGATTCAGGTTTCGCAATACTTTATCTACCCCGTTGTCATGAAG
ACAATTGCCATGAAGGAAAACGGCCTCACCTTGACCGAGAGGTTTAGAGAGTTTCCTTGGATGCTGCTGGATCTC
ATTTTCCCCTTTATGATGGAGTATCTGCTCGTCTGGTATCTCATTTGGGAAACTATTCTCAACATTCTCGCCGAG
CTTACCGGCTTTGCTGATCGCAGCTTCTACGGCCCGTGGTGGAATAGCGTCTCGTGGGATCAGTTTGCGCGCGAT
TGGAATACGCCAGTTCACGTCTTTCTCCTGCGCCATGTTTACCACAGCTCCATTTCGTCCATGAAGGTCAATAAG
CATACTGCTACCCTCATTACCTTTTTCTTCTCGGCCTGCATCCATGAGCTCGTCATGTGGTGTCTCTTTAAGAAG
CTTAGAGGTTACCTGCTCTTTTTCCAAATGTGCCAACTGCCGCTCGTCAGACTCAGCCGTACCAGATGGCTCAAG
GGCCGCAAAACACTTGGAAACTTGATGTTTTGGGCCGGCATCTTTCTCTGTCCGAGCCTATTGTGCAGCTTGTAC
CTCATACTCTGA
Transcript >OphauB2|6334
ATGGACCCTGTTAACGGTGCGCCTGCCGAGCACCGGCCGGTAAGCGCTGCATCCAACGGTCACTCTCTCGGCAAT
GGTGGGCCCCGCTCATCAAGAGCGCTGGCAGAAGTGCTCCGCGAGACTGGCGCCTCATTGGAATCTTCCTGCAAC
GGGTCTGATACGCAGAGCGAGGAAGACTATGATGAGAATGTCCGCCCAGCGTACTCGACTGGCCACCAGCGCCAG
CAGCACCAGCCCCGCGCTAGATTTTCAAATGCTTTTCCTCAGGAGCAGCCCGCCAAGCAAGCCCAGACTAACATG
GCCATTGTCCGAGATGCCACTGGGACCCATATTATTCCCGAAGACGATGGGAGCATCCAGGAACTGCTTTTGCGA
AGCTCACGGCATTTCCACGACCCCAAAGCACCCAAAAGAAAGGGACGCTTTAGTGACCTCGTCTTTACTCACCAG
TACTCTACCTTTGACTCCAACAACATTGCTGCATCAAGCAGCCCATTCCATGGCTTCTACACCCTCTTCTGGCTC
GCCATTTCACTCATGATTCTCAAAATCTTTGCCAGCAATTGGCGCGACTATGGCACGCCTCTGGGATCCAATGAA
ATTATGCACATCATGTTTTCCCGAGATGTTGCTGTTATGTTGCTCTCCGATGGCGTCATGTGTGGTCTGGGAGGA
GTAAGCTGGGCCTTGCAGAAACTCGTCTTTGCCAGGTATATCGACTGGGACCGCTCAGGGTGGATTCTCCAAAAC
ATTTGGCAGACAGTCTTCTTCACCGGCGTTGTAGGCTGGACGCTGGTGCGCGACTGGCCTTGGACACATACCGTC
TTCTTTGTCTTGCACGGCCTCGTAATGCTCATGAAGCAGCACTCGTATGCTTTTTACAATGGCTATCTCTCCACC
GTGTACCACAAGCGCCTCTTTCTGCTCTCAAGGCTCAAGCAGCTTGAATTGGTGGCACCGGCCACTGGGCCTTCA
ACGACGGCACCATCGGCCTCGACAATCAGCGTCTCGCATCTCGATGCGCCGCCGTCGGCTGAACAGCGCCGTCTC
TCCCTCTCACACTCGCCCTCCAACTCGACCGAGGAAACTGACATTGACCGCATCGCGCGTGCCATTTCCACGAGG
CAGCCACTAGATGACGAGCAAATTGATCTATTTGAGCGCATCATCAAGTGGGAGGTGGATGCTCTGGCCGATGAG
TTGCGCGGCACGGCTAGTGACCCGTGCAAGTTTTACCCCAATAACCTTACCCTGCTCAACTATTACAAGTGGATT
CCGTTACCGACTGTTGTCTACGAACTCGACTATCCGCGATGTGAAAAGGTACGTTGGCAGTATGTTGCCGAAAAG
AGCATTGCCATGGTGGGCATCATATTCGTCATGATTCAGGTTTCGCAATACTTTATCTACCCCGTTGTCATGAAG
ACAATTGCCATGAAGGAAAACGGCCTCACCTTGACCGAGAGGTTTAGAGAGTTTCCTTGGATGCTGCTGGATCTC
ATTTTCCCCTTTATGATGGAGTATCTGCTCGTCTGGTATCTCATTTGGGAAACTATTCTCAACATTCTCGCCGAG
CTTACCGGCTTTGCTGATCGCAGCTTCTACGGCCCGTGGTGGAATAGCGTCTCGTGGGATCAGTTTGCGCGCGAT
TGGAATACGCCAGTTCACGTCTTTCTCCTGCGCCATGTTTACCACAGCTCCATTTCGTCCATGAAGGTCAATAAG
CATACTGCTACCCTCATTACCTTTTTCTTCTCGGCCTGCATCCATGAGCTCGTCATGTGGTGTCTCTTTAAGAAG
CTTAGAGGTTACCTGCTCTTTTTCCAAATGTGCCAACTGCCGCTCGTCAGACTCAGCCGTACCAGATGGCTCAAG
GGCCGCAAAACACTTGGAAACTTGATGTTTTGGGCCGGCATCTTTCTCTGTCCGAGCCTATTGTGCAGCTTGTAC
CTCATACTCTGA
Gene >OphauB2|6334
ATGGACCCTGTTAACGGTGCGCCTGCCGAGCACCGGCCGGTAAGCGCTGCATCCAACGGTCACTCTCTCGGCAAT
GGTGGGCCCCGCTCATCAAGAGCGCTGGCAGAAGTGCTCCGCGAGACTGGCGCCTCATTGGAATCTTCCTGCAAC
GGGTCTGATACGCAGAGCGAGGAAGACTATGATGAGAATGTCCGCCCAGCGTACTCGACTGGCCACCAGCGCCAG
CAGCACCAGCCCCGCGCTAGATTTTCAAATGCTTTTCCTCAGGAGCAGCCCGCCAAGCAAGCCCAGACTAACATG
GCCATTGTCCGAGATGCCACTGGGACCCATATTATTCCCGAAGACGATGGGAGCATCCAGGAACTGCTTTTGCGA
AGCTCACGGCATTTCCACGACCCCAAAGCACCCAAAAGAAAGGGACGCTTTAGTGACCTCGTCTTTACTCACCAG
TACTCTACCTTTGACTCCAACAACATTGCTGCATCAAGCAGCCCATTCCATGGCTTCTACACCCTCTTCTGGCTC
GCCATTTCACTCATGATTCTCAAAATCTTTGCCAGCAATTGGCGCGACTATGGCACGCCTCTGGGATCCAATGAA
ATTATGCACATCATGTTTTCCCGAGATGGTGAGCTGGAAGCCGCAGCGCCTCACTTTAGTCTTGGTCCTGACATT
CCCGACAGTTGCTGTTATGTTGCTCTCCGATGGCGTCATGTGTGGTCTGGGAGGAGTAAGCTGGGCCTTGCAGAA
ACTCGTCTTTGCCAGGTATATCGACTGGGACCGCTCAGGGTGGATTCTCCAAAACGTGAGACGGCTCAACTCCCC
TCATCTAGCAAGACGGCATGCTGAAATTGGCGTCATAGATTTGGCAGACAGTCTTCTTCACCGGCGTTGTAGGCT
GGACGCTGGTGCGCGACTGGCCTTGGACACATACCGTCTTCTTTGTCTTGCACGGCCTCGTAATGCTCATGAAGC
AGCACTCGTATGCTTTTTACAATGGCTATCTCTCCACCGTGTACCACAAGCGCCTCTTTCTGCTCTCAAGGCTCA
AGCAGCTTGAATTGGTGGCACCGGCCACTGGGCCTTCAACGACGGCACCATCGGCCTCGACAATCAGCGTCTCGC
ATCTCGATGCGCCGCCGTCGGCTGAACAGCGCCGTCTCTCCCTCTCACACTCGCCCTCCAACTCGACCGAGGAAA
CTGACATTGACCGCATCGCGCGTGCCATTTCCACGAGGCAGCCACTAGATGACGAGCAAATTGATCTATTTGAGC
GCATCATCAAGTGGGAGGTGGATGCTCTGGCCGATGAGTTGCGCGGCACGGCTAGTGACCCGTGCAAGTTTTACC
CCAATAACCTTACCCTGCTCAACTATTACAAGTGGATTCCGTTACCGACTGTTGTCTACGAACTCGACTATCCGC
GATGTGAAAAGGTACGTTGGCAGTATGTTGCCGAAAAGAGCATTGCCATGGTGGGCATCATATTCGTCATGATTC
AGGTTTCGCAATACTTTATCTGTGAGTTGTTGCCTTGCTTTTCTCCTATTGGCTCAAATCTAACGTTTTGTAAAA
GACCCCGTTGTCATGAAGACAATTGCCATGAAGGAAAACGGCCTCACCTTGACCGAGAGGTTTAGAGAGTTTCCT
TGGATGCTGCTGGATCTCATTTTCCCCTTTATGATGGAGTATCTGGTGCGTTTGCGTGTCGACGATAACTCGCGA
GATGCTCGGCTGACAGAGTGGCAACAGCTCGTCTGGTATCTCATTTGGGAAACTATTCTCAACATTCTCGCCGAG
CTTACCGGCTTTGCTGATCGCAGCTTCTACGGCCCGTGGTGGAATAGCGGTATGTGGGCGAGCCAGCCAGTCTTG
AATGCGGCGCTGACGTGTTTTGTAGTCTCGTGGGATCAGTTTGCGCGCGATTGGAATACGCCAGTTCACGTCTTT
CTCCTGCGCCATGTTTACCACAGCTCCATTTCGTCCATGAAGGTCAATAAGCATACTGCTACCCTCATTACCTTT
TTCTTCTCGGCCTGCATCCATGAGCTCGTCATGTGGTGTCTCTTTAAGAAGCTTAGAGGTTACCTGCTCTTTTTC
CAAATGTGCCAACTGCCGGTTCGTCATCCCCCCCTCTCCCTCCCCCTTGTTTTTTTTCCTTCTTCATACTTGTTG
CTTCGTCTTCTTGTCGCTAGAGGACCGACTTGTTGGCGCGTGAGCACCAAACTAACTTGTTGTGCAGCTCGTCAG
ACTCAGCCGTACCAGATGGCTCAAGGGCCGCAAAACACTTGGAAACTTGATGTTTTGGGCCGGCATCTTTCTCTG
TCCGAGCCTATTGTGCAGCTTGTACCTCATACTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail