Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6331
Gene name
LocationContig_57:79271..79931
Strand+
Gene length (bp)660
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02214 BTB_2 BTB/POZ domain 1.0E-06 18 108

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9H3F6|BACD3_HUMAN BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3 OS=Homo sapiens GN=KCTD10 PE=1 SV=1 18 112 3.0E-07
sp|Q7TPL3|BACD3_RAT BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3 OS=Rattus norvegicus GN=Kctd10 PE=1 SV=1 18 112 9.0E-07
sp|Q54KH0|Y7435_DICDI Uncharacterized protein DDB_G0287347 OS=Dictyostelium discoideum GN=DDB_G0287347 PE=3 SV=2 27 122 9.0E-07
sp|Q922M3|BACD3_MOUSE BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3 OS=Mus musculus GN=Kctd10 PE=1 SV=1 18 112 1.0E-06

GO

GO Term Description Terminal node
GO:0051260 protein homooligomerization Yes
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0043933 protein-containing complex organization No
GO:0051259 protein complex oligomerization No
GO:0022607 cellular component assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6331
MRPPIANGSASAIQATKIKLQIGERIFVTTLETLVRESTYFAALLTGRWETIAQPIFVDADAELFEYVLRYLRRG
LFPLFYTTGIGHDHAQYYALLGEAKFFGIQKLVMWLQHRRYFQAITTTMDFEIFKTTQAVLDSGSGVDSHTTTQL
FPWWSNQKVYVCPRGISLHRGAPTRCGRMCLRSQRNDANVYEDEAVLKMLKVMTKTDINYYVMESGLYT*
Coding >OphauB2|6331
ATGCGCCCCCCCATTGCAAACGGATCCGCCTCCGCCATTCAAGCTACTAAGATCAAGCTCCAAATCGGCGAACGC
ATCTTTGTCACCACGCTCGAAACCCTGGTTCGCGAAAGCACCTACTTTGCCGCCCTCCTAACTGGCCGCTGGGAA
ACTATTGCGCAACCCATTTTTGTCGACGCCGACGCCGAGCTCTTTGAATACGTGCTACGCTACCTCCGCCGCGGA
CTCTTCCCCCTCTTCTACACGACAGGCATAGGCCACGACCACGCCCAATACTATGCCCTGCTGGGCGAGGCCAAG
TTTTTTGGCATTCAAAAACTAGTGATGTGGCTGCAGCATAGGCGCTACTTTCAAGCAATCACAACTACAATGGAC
TTTGAAATATTTAAAACTACCCAAGCGGTGCTCGACTCGGGCAGCGGCGTCGACTCGCACACCACGACTCAACTC
TTTCCCTGGTGGTCCAATCAAAAGGTGTATGTTTGTCCGCGCGGCATCTCGCTGCATCGGGGGGCGCCGACGCGC
TGTGGGCGAATGTGTCTCAGGTCGCAGCGCAACGACGCCAATGTGTACGAGGACGAGGCGGTGCTAAAGATGCTA
AAGGTTATGACCAAGACGGATATTAATTACTATGTCATGGAGTCGGGGCTTTATACTTGA
Transcript >OphauB2|6331
ATGCGCCCCCCCATTGCAAACGGATCCGCCTCCGCCATTCAAGCTACTAAGATCAAGCTCCAAATCGGCGAACGC
ATCTTTGTCACCACGCTCGAAACCCTGGTTCGCGAAAGCACCTACTTTGCCGCCCTCCTAACTGGCCGCTGGGAA
ACTATTGCGCAACCCATTTTTGTCGACGCCGACGCCGAGCTCTTTGAATACGTGCTACGCTACCTCCGCCGCGGA
CTCTTCCCCCTCTTCTACACGACAGGCATAGGCCACGACCACGCCCAATACTATGCCCTGCTGGGCGAGGCCAAG
TTTTTTGGCATTCAAAAACTAGTGATGTGGCTGCAGCATAGGCGCTACTTTCAAGCAATCACAACTACAATGGAC
TTTGAAATATTTAAAACTACCCAAGCGGTGCTCGACTCGGGCAGCGGCGTCGACTCGCACACCACGACTCAACTC
TTTCCCTGGTGGTCCAATCAAAAGGTGTATGTTTGTCCGCGCGGCATCTCGCTGCATCGGGGGGCGCCGACGCGC
TGTGGGCGAATGTGTCTCAGGTCGCAGCGCAACGACGCCAATGTGTACGAGGACGAGGCGGTGCTAAAGATGCTA
AAGGTTATGACCAAGACGGATATTAATTACTATGTCATGGAGTCGGGGCTTTATACTTGA
Gene >OphauB2|6331
ATGCGCCCCCCCATTGCAAACGGATCCGCCTCCGCCATTCAAGCTACTAAGATCAAGCTCCAAATCGGCGAACGC
ATCTTTGTCACCACGCTCGAAACCCTGGTTCGCGAAAGCACCTACTTTGCCGCCCTCCTAACTGGCCGCTGGGAA
ACTATTGCGCAACCCATTTTTGTCGACGCCGACGCCGAGCTCTTTGAATACGTGCTACGCTACCTCCGCCGCGGA
CTCTTCCCCCTCTTCTACACGACAGGCATAGGCCACGACCACGCCCAATACTATGCCCTGCTGGGCGAGGCCAAG
TTTTTTGGCATTCAAAAACTAGTGATGTGGCTGCAGCATAGGCGCTACTTTCAAGCAATCACAACTACAATGGAC
TTTGAAATATTTAAAACTACCCAAGCGGTGCTCGACTCGGGCAGCGGCGTCGACTCGCACACCACGACTCAACTC
TTTCCCTGGTGGTCCAATCAAAAGGTGTATGTTTGTCCGCGCGGCATCTCGCTGCATCGGGGGGCGCCGACGCGC
TGTGGGCGAATGTGTCTCAGGTCGCAGCGCAACGACGCCAATGTGTACGAGGACGAGGCGGTGCTAAAGATGCTA
AAGGTTATGACCAAGACGGATATTAATTACTATGTCATGGAGTCGGGGCTTTATACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail