Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6329
Gene name
LocationContig_57:70482..75381
Strand+
Gene length (bp)4899
Transcript length (bp)4668
Coding sequence length (bp)4668
Protein length (aa) 1556

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19050 PhoD_2 PhoD related phosphatase 7.5E-43 843 1095
PF19050 PhoD_2 PhoD related phosphatase 1.4E-20 1103 1261

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53326|YG5L_YEAST Uncharacterized protein YGR266W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR266W PE=1 SV=1 805 1257 2.0E-105

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5159
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2969
Ophiocordyceps australis map64 (Brazil) OphauB2|6329 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02639
Ophiocordyceps kimflemingae Ophio5|7417
Ophiocordyceps subramaniannii Hirsu2|3657

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6329
MSAAPYWGQLPDAKTTKEGHDGLPSDHGHSVHVPSVPRRARRNSIAMTDSYTDTTFSPHTPLTPSFGLAPRPLSI
HRGPDAPPQSMPRPNDQFSPVSHPAAGPDPRGPPVTYRAAYSNGDAPYSHPSGPPNARPRPQPIYQDPRGDLDLG
LAVDYVPRRDAPQDSYQRPMHDMQARVDAPPAAMEGAGQREPPVAMRQSERRRNMTKEEKRARVEAAEQRARQRA
AGKTQHSPTSPSQQTPADDHYVFSARHHQAEAAAEQQSASPRPQSNAMPNMPPHSDLPSQRHPIPLNRDRPQRAY
NNPMPPPRLVPEQASHDREPTAATFPQRNLSFRERASTNDPQSPNSAQVRQQPFPNPEGYPPPLNTNMHKVRKEP
PRDFEYRQQLLGNRSASGPGPFLSATHARVRTLPVSLADKQLAPAPVNRPLGATGIPDSHLASHPAWASDKQAPP
PGMQGIRRHVTEPVYGRKADVVVDEASPLERNQIHEEAPVQETANNEQPAAPPQQDANRSLEFKDRLARQDSADM
SDQGTHNEGSDILRRQESLKPGHGLYKAPEWLNEWKRATTGLLSGTLLDLGDTQPTIGPGRPPREMGARGLSSTY
PPSRRRRAEAFDGEYNDANAPTRFKPPLYLSCGPLLRYRGIRRERFPTRSPRGDTSVSEREIWRGSIMIVTKDSD
SSYEISPTLRLFVQQVKLLPPPPHQIRGETPPEYVDPIAGHPKLGRSGETLYVRPVEDLDEARDHSLDETNKGIF
ETANQAANMQPADSETDCPGSFTHRRKAIDIDGEKMQKFKDVRGFRLHIERGCTFWRFNIEVELRDEQQRIAYRI
NRGPPMGFWVPPRGEAMNIMFYSCNGFSPNVKSDELSGPDPMWRDVLNSHQSRPFHVMIGGGDQIYNDRLAYNSP
LFDDWLEERDAHEKRNAPFSAAMQDELEAFYLERYCTWFSQGLFGLAVSQIPMVNMYDNHDVFDGYGSYPHLNMA
SPVFCGLGAVAFKYYMLFQHQSLVTETEKSEPSWILSLEPGPYIKELSHSIYVSLGGKVALLAVDCRTERTESEV
VREKTWERIMNRMYSEIRRGQMEHLLLVLGTPIAYPRLVWLENILTSRLMGPVKALGKTGMLGKAMNDIDGGADA
RDDLNEHWTAKKHKQERSLVIEDLQDLAIDKSLRITILSGDVHMAAVGQFFSSPKLGLPKHKDPRYMPNVIASPM
ANAPPSDFMADVINKRNKVHHFDKQTDENMIPLFRHGVDGKVRNNPHLLPHRNWCSISLWTPGSTPPPTPPRSSY
EERHSPSPHANSSGGLLRRLSSRRKSAPRRIEGAHESVRGPRPPISGGMGFFQNISRRLSWSDGQGLTRTMSLGR
GEGRDRGYLNYAYRNSESQPGADEADLHGQWHTDDYEGLGPAPARTPLRPSGLRGGALHDEYKEDDESYFSASHP
ARLAQTMDSLPAATTHRADSPPRRAFHRTPTNLSAKQLRQSERFQVDVEGALEVVLNIEVSPRDPAGITVPYRLL
VPRLQYEYNPSEDDIALKEQAEGSALKRLLGLGKRTEKVRCYELEGAETDEAVHG*
Coding >OphauB2|6329
ATGTCGGCCGCGCCATACTGGGGCCAGCTGCCCGACGCAAAGACGACCAAGGAGGGCCACGATGGCTTGCCATCC
GACCACGGCCATTCTGTCCATGTTCCCTCGGTGCCGCGCCGAGCGCGCCGCAACTCCATCGCAATGACTGATAGC
TACACCGACACCACCTTTAGCCCTCACACGCCTCTCACGCCTAGTTTTGGCCTTGCCCCCCGCCCGCTGTCGATT
CATCGCGGCCCGGATGCGCCTCCGCAGAGCATGCCTCGCCCCAACGACCAATTCTCCCCCGTCTCCCATCCTGCT
GCAGGCCCGGATCCGCGAGGGCCGCCCGTCACCTACCGTGCCGCCTACTCCAACGGCGATGCCCCCTATTCCCAT
CCGTCTGGCCCACCCAATGCTAGACCCCGTCCGCAGCCCATATACCAGGATCCTCGAGGAGACTTGGACTTGGGA
CTCGCAGTTGACTATGTCCCAAGGCGTGATGCCCCGCAAGACTCGTACCAGAGGCCCATGCACGACATGCAGGCT
CGCGTCGACGCACCGCCCGCTGCCATGGAAGGCGCTGGGCAGCGCGAGCCACCCGTCGCAATGAGGCAATCAGAG
CGCCGCAGAAATATGACCAAGGAGGAAAAGAGAGCCAGAGTCGAAGCAGCTGAGCAGAGAGCCAGACAGCGAGCA
GCCGGCAAGACCCAACACTCACCAACTAGTCCGAGCCAACAGACGCCAGCCGACGACCATTATGTCTTTTCTGCG
CGCCATCATCAAGCAGAAGCAGCAGCTGAGCAGCAGTCTGCTTCGCCTAGACCTCAAAGCAATGCTATGCCCAAT
ATGCCGCCCCATTCTGACTTGCCGTCGCAACGTCACCCGATTCCGCTCAACCGTGACCGACCCCAACGCGCTTAC
AACAATCCCATGCCGCCCCCCAGATTGGTGCCCGAGCAAGCATCCCATGATCGTGAGCCGACGGCAGCCACCTTT
CCACAGCGGAATCTGAGCTTCCGTGAGCGTGCTTCGACAAATGATCCACAGTCTCCCAACTCTGCCCAAGTGCGA
CAACAACCCTTTCCCAATCCAGAAGGCTATCCTCCTCCCCTCAACACAAACATGCACAAGGTGAGAAAAGAGCCA
CCGAGAGACTTTGAGTACCGCCAGCAACTCTTGGGCAACCGATCGGCTTCGGGACCTGGCCCGTTTCTGAGCGCG
ACACACGCCCGTGTAAGGACTTTGCCCGTATCATTGGCGGACAAGCAACTAGCGCCAGCGCCCGTGAACCGACCC
TTGGGAGCAACAGGAATCCCTGATAGTCACCTGGCCTCGCATCCGGCTTGGGCCTCTGATAAACAGGCGCCGCCT
CCTGGCATGCAAGGTATTCGACGACATGTTACTGAGCCCGTCTACGGAAGGAAAGCCGACGTTGTTGTCGATGAA
GCCTCGCCTCTGGAACGAAACCAAATACATGAAGAAGCGCCAGTCCAAGAGACTGCCAACAATGAGCAACCAGCC
GCTCCTCCTCAGCAAGATGCGAACAGGTCATTGGAATTCAAGGATCGGCTGGCAAGACAAGATAGCGCCGACATG
TCAGATCAAGGTACTCACAATGAAGGTTCTGATATTTTGAGGAGACAGGAGAGCTTGAAGCCGGGCCATGGCCTA
TACAAAGCGCCAGAATGGCTGAATGAATGGAAGAGGGCAACAACAGGGCTACTCTCCGGTACCTTGTTGGACCTA
GGCGACACACAACCTACTATAGGCCCAGGCAGACCTCCGCGCGAAATGGGTGCACGGGGACTGAGCAGCACCTAC
CCACCATCTCGTCGACGGAGAGCCGAGGCTTTCGACGGAGAATACAACGACGCCAATGCACCGACGCGGTTCAAG
CCGCCTTTGTATCTCAGCTGTGGTCCTCTGTTGAGATACCGTGGCATTCGACGAGAACGATTTCCTACCAGGTCT
CCCAGAGGCGACACCTCGGTATCGGAGCGAGAAATTTGGAGAGGCAGCATCATGATTGTGACCAAGGACTCGGAT
TCGTCGTATGAGATATCTCCGACGCTGCGCCTCTTTGTCCAACAAGTCAAACTGCTACCCCCTCCACCTCACCAG
ATTAGGGGGGAAACACCACCTGAATATGTAGATCCCATAGCTGGCCACCCCAAGTTGGGTCGATCGGGGGAGACG
TTGTACGTGCGTCCGGTCGAGGATCTCGATGAAGCCAGAGACCATTCTCTTGACGAAACGAACAAGGGCATTTTT
GAGACGGCCAATCAGGCTGCAAATATGCAGCCAGCGGATAGTGAAACGGATTGCCCAGGATCATTTACGCATCGC
AGAAAGGCTATTGACATTGACGGCGAAAAGATGCAAAAGTTCAAGGATGTAAGAGGATTCCGTCTACACATTGAA
CGAGGCTGTACCTTTTGGAGGTTCAACATTGAAGTGGAGCTACGGGACGAGCAACAGCGCATTGCATACCGCATC
AATCGTGGACCCCCCATGGGCTTTTGGGTGCCGCCACGGGGTGAGGCTATGAACATCATGTTTTACAGCTGCAAT
GGCTTTAGTCCCAACGTCAAGTCGGACGAGTTGAGCGGACCGGATCCCATGTGGAGAGACGTGCTCAACTCGCAT
CAGTCGCGACCATTTCATGTCATGATTGGAGGTGGCGACCAAATTTACAATGACCGCCTCGCGTACAACAGTCCT
CTGTTTGACGATTGGCTGGAAGAGAGAGATGCACACGAGAAGCGTAACGCACCTTTTAGCGCAGCAATGCAGGAT
GAGCTTGAGGCTTTTTACTTGGAGCGATATTGCACATGGTTCTCTCAGGGCCTCTTTGGCCTGGCCGTTTCCCAG
ATACCCATGGTCAACATGTACGACAACCATGACGTTTTTGACGGCTATGGCTCCTACCCGCACCTCAACATGGCC
TCACCCGTCTTTTGTGGACTCGGGGCTGTGGCATTCAAATACTATATGCTCTTTCAACATCAGAGCCTGGTAACG
GAAACTGAAAAGTCGGAGCCAAGCTGGATCTTGAGTCTGGAGCCCGGCCCGTACATCAAGGAGCTCAGTCACAGC
ATATACGTGTCTCTGGGAGGCAAAGTGGCACTGTTGGCTGTCGACTGTCGCACTGAGAGAACCGAGTCCGAGGTT
GTTCGAGAGAAGACGTGGGAAAGGATTATGAATCGCATGTACTCGGAGATTAGACGGGGGCAGATGGAGCATCTC
TTATTGGTTTTGGGAACGCCCATTGCCTATCCTCGTCTGGTCTGGCTGGAGAATATTTTGACATCAAGGCTCATG
GGTCCGGTCAAGGCTTTGGGCAAAACGGGCATGCTAGGCAAAGCCATGAATGATATTGACGGCGGCGCCGACGCG
CGAGATGACCTGAACGAGCACTGGACGGCCAAGAAGCACAAGCAGGAACGAAGTCTTGTTATCGAAGACTTGCAG
GATCTGGCCATTGACAAGTCTTTGCGCATCACAATTCTAAGCGGCGACGTGCACATGGCGGCCGTTGGACAATTC
TTCTCGTCTCCCAAGCTTGGCTTACCAAAACACAAGGATCCGCGGTATATGCCCAACGTGATTGCATCTCCAATG
GCGAATGCGCCACCTTCAGATTTCATGGCCGACGTGATCAATAAGCGGAACAAGGTGCACCATTTCGATAAGCAG
ACGGACGAAAACATGATTCCCCTCTTCCGGCACGGGGTGGATGGCAAAGTAAGGAATAACCCGCACTTACTGCCG
CATAGAAACTGGTGCTCGATTAGCCTGTGGACGCCAGGCAGCACACCGCCCCCAACGCCACCGCGTTCCTCGTAC
GAGGAGCGCCACAGCCCCTCGCCTCATGCAAACAGCAGCGGCGGCCTGCTGAGAAGATTGTCTTCACGGCGCAAG
TCGGCGCCACGGCGCATCGAGGGCGCTCACGAGTCGGTTCGAGGGCCTCGACCACCTATATCAGGCGGCATGGGC
TTCTTCCAAAATATATCGCGGCGGCTATCTTGGTCAGACGGACAAGGTCTCACGCGCACCATGTCGCTGGGCCGC
GGAGAGGGCAGGGATAGAGGATACTTGAACTATGCCTACAGAAACAGCGAGAGCCAGCCCGGGGCCGACGAAGCA
GACCTGCATGGCCAATGGCACACTGATGACTACGAGGGCCTTGGACCGGCTCCTGCGCGCACCCCCTTGCGCCCT
TCTGGCTTGCGCGGCGGCGCCCTGCACGACGAGTACAAGGAGGACGACGAATCCTACTTTAGCGCCTCGCACCCG
GCCCGCCTTGCCCAGACCATGGACAGTCTGCCCGCAGCAACGACGCATCGTGCCGACTCGCCCCCGCGCCGCGCC
TTTCACCGTACGCCAACCAACCTCTCGGCCAAACAGCTGCGCCAGTCGGAGCGCTTCCAAGTCGACGTTGAAGGC
GCGCTCGAGGTGGTGCTCAACATTGAGGTGAGCCCGCGCGACCCTGCTGGCATCACGGTGCCCTACCGTCTGCTG
GTGCCTCGTCTGCAGTACGAGTATAACCCGTCGGAAGACGACATTGCCCTCAAGGAACAAGCCGAGGGAAGCGCG
TTGAAGCGGCTGCTTGGCTTGGGGAAACGGACAGAAAAGGTGCGGTGCTACGAGCTCGAGGGCGCCGAGACGGAC
GAGGCGGTGCATGGATGA
Transcript >OphauB2|6329
ATGTCGGCCGCGCCATACTGGGGCCAGCTGCCCGACGCAAAGACGACCAAGGAGGGCCACGATGGCTTGCCATCC
GACCACGGCCATTCTGTCCATGTTCCCTCGGTGCCGCGCCGAGCGCGCCGCAACTCCATCGCAATGACTGATAGC
TACACCGACACCACCTTTAGCCCTCACACGCCTCTCACGCCTAGTTTTGGCCTTGCCCCCCGCCCGCTGTCGATT
CATCGCGGCCCGGATGCGCCTCCGCAGAGCATGCCTCGCCCCAACGACCAATTCTCCCCCGTCTCCCATCCTGCT
GCAGGCCCGGATCCGCGAGGGCCGCCCGTCACCTACCGTGCCGCCTACTCCAACGGCGATGCCCCCTATTCCCAT
CCGTCTGGCCCACCCAATGCTAGACCCCGTCCGCAGCCCATATACCAGGATCCTCGAGGAGACTTGGACTTGGGA
CTCGCAGTTGACTATGTCCCAAGGCGTGATGCCCCGCAAGACTCGTACCAGAGGCCCATGCACGACATGCAGGCT
CGCGTCGACGCACCGCCCGCTGCCATGGAAGGCGCTGGGCAGCGCGAGCCACCCGTCGCAATGAGGCAATCAGAG
CGCCGCAGAAATATGACCAAGGAGGAAAAGAGAGCCAGAGTCGAAGCAGCTGAGCAGAGAGCCAGACAGCGAGCA
GCCGGCAAGACCCAACACTCACCAACTAGTCCGAGCCAACAGACGCCAGCCGACGACCATTATGTCTTTTCTGCG
CGCCATCATCAAGCAGAAGCAGCAGCTGAGCAGCAGTCTGCTTCGCCTAGACCTCAAAGCAATGCTATGCCCAAT
ATGCCGCCCCATTCTGACTTGCCGTCGCAACGTCACCCGATTCCGCTCAACCGTGACCGACCCCAACGCGCTTAC
AACAATCCCATGCCGCCCCCCAGATTGGTGCCCGAGCAAGCATCCCATGATCGTGAGCCGACGGCAGCCACCTTT
CCACAGCGGAATCTGAGCTTCCGTGAGCGTGCTTCGACAAATGATCCACAGTCTCCCAACTCTGCCCAAGTGCGA
CAACAACCCTTTCCCAATCCAGAAGGCTATCCTCCTCCCCTCAACACAAACATGCACAAGGTGAGAAAAGAGCCA
CCGAGAGACTTTGAGTACCGCCAGCAACTCTTGGGCAACCGATCGGCTTCGGGACCTGGCCCGTTTCTGAGCGCG
ACACACGCCCGTGTAAGGACTTTGCCCGTATCATTGGCGGACAAGCAACTAGCGCCAGCGCCCGTGAACCGACCC
TTGGGAGCAACAGGAATCCCTGATAGTCACCTGGCCTCGCATCCGGCTTGGGCCTCTGATAAACAGGCGCCGCCT
CCTGGCATGCAAGGTATTCGACGACATGTTACTGAGCCCGTCTACGGAAGGAAAGCCGACGTTGTTGTCGATGAA
GCCTCGCCTCTGGAACGAAACCAAATACATGAAGAAGCGCCAGTCCAAGAGACTGCCAACAATGAGCAACCAGCC
GCTCCTCCTCAGCAAGATGCGAACAGGTCATTGGAATTCAAGGATCGGCTGGCAAGACAAGATAGCGCCGACATG
TCAGATCAAGGTACTCACAATGAAGGTTCTGATATTTTGAGGAGACAGGAGAGCTTGAAGCCGGGCCATGGCCTA
TACAAAGCGCCAGAATGGCTGAATGAATGGAAGAGGGCAACAACAGGGCTACTCTCCGGTACCTTGTTGGACCTA
GGCGACACACAACCTACTATAGGCCCAGGCAGACCTCCGCGCGAAATGGGTGCACGGGGACTGAGCAGCACCTAC
CCACCATCTCGTCGACGGAGAGCCGAGGCTTTCGACGGAGAATACAACGACGCCAATGCACCGACGCGGTTCAAG
CCGCCTTTGTATCTCAGCTGTGGTCCTCTGTTGAGATACCGTGGCATTCGACGAGAACGATTTCCTACCAGGTCT
CCCAGAGGCGACACCTCGGTATCGGAGCGAGAAATTTGGAGAGGCAGCATCATGATTGTGACCAAGGACTCGGAT
TCGTCGTATGAGATATCTCCGACGCTGCGCCTCTTTGTCCAACAAGTCAAACTGCTACCCCCTCCACCTCACCAG
ATTAGGGGGGAAACACCACCTGAATATGTAGATCCCATAGCTGGCCACCCCAAGTTGGGTCGATCGGGGGAGACG
TTGTACGTGCGTCCGGTCGAGGATCTCGATGAAGCCAGAGACCATTCTCTTGACGAAACGAACAAGGGCATTTTT
GAGACGGCCAATCAGGCTGCAAATATGCAGCCAGCGGATAGTGAAACGGATTGCCCAGGATCATTTACGCATCGC
AGAAAGGCTATTGACATTGACGGCGAAAAGATGCAAAAGTTCAAGGATGTAAGAGGATTCCGTCTACACATTGAA
CGAGGCTGTACCTTTTGGAGGTTCAACATTGAAGTGGAGCTACGGGACGAGCAACAGCGCATTGCATACCGCATC
AATCGTGGACCCCCCATGGGCTTTTGGGTGCCGCCACGGGGTGAGGCTATGAACATCATGTTTTACAGCTGCAAT
GGCTTTAGTCCCAACGTCAAGTCGGACGAGTTGAGCGGACCGGATCCCATGTGGAGAGACGTGCTCAACTCGCAT
CAGTCGCGACCATTTCATGTCATGATTGGAGGTGGCGACCAAATTTACAATGACCGCCTCGCGTACAACAGTCCT
CTGTTTGACGATTGGCTGGAAGAGAGAGATGCACACGAGAAGCGTAACGCACCTTTTAGCGCAGCAATGCAGGAT
GAGCTTGAGGCTTTTTACTTGGAGCGATATTGCACATGGTTCTCTCAGGGCCTCTTTGGCCTGGCCGTTTCCCAG
ATACCCATGGTCAACATGTACGACAACCATGACGTTTTTGACGGCTATGGCTCCTACCCGCACCTCAACATGGCC
TCACCCGTCTTTTGTGGACTCGGGGCTGTGGCATTCAAATACTATATGCTCTTTCAACATCAGAGCCTGGTAACG
GAAACTGAAAAGTCGGAGCCAAGCTGGATCTTGAGTCTGGAGCCCGGCCCGTACATCAAGGAGCTCAGTCACAGC
ATATACGTGTCTCTGGGAGGCAAAGTGGCACTGTTGGCTGTCGACTGTCGCACTGAGAGAACCGAGTCCGAGGTT
GTTCGAGAGAAGACGTGGGAAAGGATTATGAATCGCATGTACTCGGAGATTAGACGGGGGCAGATGGAGCATCTC
TTATTGGTTTTGGGAACGCCCATTGCCTATCCTCGTCTGGTCTGGCTGGAGAATATTTTGACATCAAGGCTCATG
GGTCCGGTCAAGGCTTTGGGCAAAACGGGCATGCTAGGCAAAGCCATGAATGATATTGACGGCGGCGCCGACGCG
CGAGATGACCTGAACGAGCACTGGACGGCCAAGAAGCACAAGCAGGAACGAAGTCTTGTTATCGAAGACTTGCAG
GATCTGGCCATTGACAAGTCTTTGCGCATCACAATTCTAAGCGGCGACGTGCACATGGCGGCCGTTGGACAATTC
TTCTCGTCTCCCAAGCTTGGCTTACCAAAACACAAGGATCCGCGGTATATGCCCAACGTGATTGCATCTCCAATG
GCGAATGCGCCACCTTCAGATTTCATGGCCGACGTGATCAATAAGCGGAACAAGGTGCACCATTTCGATAAGCAG
ACGGACGAAAACATGATTCCCCTCTTCCGGCACGGGGTGGATGGCAAAGTAAGGAATAACCCGCACTTACTGCCG
CATAGAAACTGGTGCTCGATTAGCCTGTGGACGCCAGGCAGCACACCGCCCCCAACGCCACCGCGTTCCTCGTAC
GAGGAGCGCCACAGCCCCTCGCCTCATGCAAACAGCAGCGGCGGCCTGCTGAGAAGATTGTCTTCACGGCGCAAG
TCGGCGCCACGGCGCATCGAGGGCGCTCACGAGTCGGTTCGAGGGCCTCGACCACCTATATCAGGCGGCATGGGC
TTCTTCCAAAATATATCGCGGCGGCTATCTTGGTCAGACGGACAAGGTCTCACGCGCACCATGTCGCTGGGCCGC
GGAGAGGGCAGGGATAGAGGATACTTGAACTATGCCTACAGAAACAGCGAGAGCCAGCCCGGGGCCGACGAAGCA
GACCTGCATGGCCAATGGCACACTGATGACTACGAGGGCCTTGGACCGGCTCCTGCGCGCACCCCCTTGCGCCCT
TCTGGCTTGCGCGGCGGCGCCCTGCACGACGAGTACAAGGAGGACGACGAATCCTACTTTAGCGCCTCGCACCCG
GCCCGCCTTGCCCAGACCATGGACAGTCTGCCCGCAGCAACGACGCATCGTGCCGACTCGCCCCCGCGCCGCGCC
TTTCACCGTACGCCAACCAACCTCTCGGCCAAACAGCTGCGCCAGTCGGAGCGCTTCCAAGTCGACGTTGAAGGC
GCGCTCGAGGTGGTGCTCAACATTGAGGTGAGCCCGCGCGACCCTGCTGGCATCACGGTGCCCTACCGTCTGCTG
GTGCCTCGTCTGCAGTACGAGTATAACCCGTCGGAAGACGACATTGCCCTCAAGGAACAAGCCGAGGGAAGCGCG
TTGAAGCGGCTGCTTGGCTTGGGGAAACGGACAGAAAAGGTGCGGTGCTACGAGCTCGAGGGCGCCGAGACGGAC
GAGGCGGTGCATGGATGA
Gene >OphauB2|6329
ATGTCGGCCGCGCCATACTGGGGCCAGCTGCCCGACGCAAAGACGACCAAGGAGGGCCACGATGGCTTGCCATCC
GACCACGGCCATTCTGTCCATGTTCCCTCGGTGCCGCGCCGAGCGCGCCGCAACTCCATCGCAATGACTGATAGC
TACACCGACACCACCTTTAGCCCTCACACGCCTCTCACGCCTAGTTTTGGCCTTGCCCCCCGCCCGCTGTCGATT
CATCGCGGCCCGGATGCGCCTCCGCAGAGCATGCCTCGCCCCAACGACCAATTCTCCCCCGTCTCCCATCCTGCT
GCAGGCCCGGATCCGCGAGGGCCGCCCGTCACCTACCGTGCCGCCTACTCCAACGGCGATGCCCCCTATTCCCAT
CCGTCTGGCCCACCCAATGCTAGACCCCGTCCGCAGCCCATATACCAGGATCCTCGAGGAGACTTGGACTTGGGA
CTCGCAGTTGACTATGTCCCAAGGCGTGATGCCCCGCAAGACTCGTACCAGAGGCCCATGCACGACATGCAGGCT
CGCGTCGACGCACCGCCCGCTGCCATGGAAGGCGCTGGGCAGCGCGAGCCACCCGTCGCAATGAGGCAATCAGAG
CGCCGCAGAAAGTTGGCAACCGAACGATCTCCGCTTCAGAAGCTTGAGCTGACGCTCGACAGTATGACCAAGGAG
GAAAAGAGAGCCAGAGTCGAAGCAGCTGAGCAGAGAGCCAGACAGCGAGCAGCCGGCAAGACCCAACACTCACCA
ACTAGTCCGAGCCAACAGACGCCAGCCGACGACCATTATGTCTTTTCTGCGCGCCATCATCAAGCAGAAGCAGCA
GCTGAGCAGCAGTCTGCTTCGCCTAGACCTCAAAGCAATGCTATGCCCAATATGCCGCCCCATTCTGACTTGCCG
TCGCAACGTCACCCGATTCCGCTCAACCGTGACCGACCCCAACGCGCTTACAACAATCCCATGCCGCCCCCCAGA
TTGGTGCCCGAGCAAGCATCCCATGATCGTGAGCCGACGGCAGCCACCTTTCCACAGCGGAATCTGAGCTTCCGT
GAGCGTGCTTCGACAAATGATCCACAGTCTCCCAACTCTGCCCAAGTGCGACAACAACCCTTTCCCAATCCAGAA
GGCTATCCTCCTCCCCTCAACACAAACATGCACAAGGTGAGAAAAGAGCCACCGAGAGACTTTGAGTACCGCCAG
CAACTCTTGGGCAACCGATCGGCTTCGGGACCTGGCCCGTTTCTGAGCGCGACACACGCCCGTGTAAGGACTTTG
CCCGTATCATTGGCGGACAAGCAACTAGCGCCAGCGCCCGTGAACCGACCCTTGGGAGCAACAGGAATCCCTGAT
AGTCACCTGGCCTCGCATCCGGCTTGGGCCTCTGATAAACAGGCGCCGCCTCCTGGCATGCAAGGTATTCGACGA
CATGTTACTGAGCCCGTCTACGGAAGGAAAGCCGACGTTGTTGTCGATGAAGCCTCGCCTCTGGAACGAAACCAA
ATACATGAAGAAGCGCCAGTCCAAGAGACTGCCAACAATGAGCAACCAGCCGCTCCTCCTCAGCAAGATGCGAAC
AGGTCATTGGAATTCAAGGATCGGCTGGCAAGACAAGATAGCGCCGACATGTCAGATCAAGGTACTCACAATGAA
GGTTCTGATATTTTGAGGAGACAGGAGAGCTTGAAGCCGGGCCATGGCCTATACAAAGCGCCAGAATGGCTGAAT
GAATGGAAGAGGGCAACAACAGGGCTACTCTCCGGTACCTTGTTGGACCTAGGCGACACACAACCTACTATAGGC
CCAGGCAGACCTCCGCGCGAAATGGGTGCACGGGGACTGAGCAGCACCTACCCACCATCTCGTCGACGGAGAGCC
GAGGCTTTCGACGGAGAATACAACGACGCCAATGGTGAGTTGGTCCAGCCACGTGATTTCAACAGAGACTATATT
AACACGCATTGCCAGCACCGACGCGGTTCAAGCCGCCTTTGTATCTCAGCTGTGGTCCTCTGTTGAGATACCGTG
GCATTCGACGAGAACGATTTCCTACCAGGTCTCCCAGAGGCGACACCTCGGTATCGGAGCGAGAAATTTGGAGAG
GCAGCATCATGATTGTGACCAAGGACTCGGATTCGTCGTATGAGATATCTCCGACGCTGCGCCTCTTTGTCCAAC
AAGTCAAACTGCTACCCCCTCCACCTCACCAGATTAGGGGGGAAACACCACCTGAATATGTAGATCCCATAGCTG
GCCACCCCAAGTTGGGTCGATCGGGGGAGACGTTGTACGTGCGTCCGGTCGAGGATCTCGATGAAGCCAGAGACC
ATTCTCTTGACGAAACGAACAAGGGCATTTTTGAGACGGCCAATCAGGCTGCAAATATGCAGCCAGCGGATAGTG
AAACGGATTGCCCAGGATCATTTACGCATCGCAGAAAGGCTATTGACATTGACGGCGAAAAGATGCAAAAGTTCA
AGGATGTAAGAGGATTCCGTCTACACATTGAACGAGGCTGTACCTTTTGGAGGTTCAACATTGAAGTGGAGCTAC
GGGACGAGCAACAGCGCATTGCATACCGCATCAATCGTGGACCCCCCATGGGCTTTTGGGTGCCGCCACGGGGTG
AGGCTATGAACATCATGTTTTACAGCTGCAATGGCTTTAGTCCCAACGTCAAGTCGGACGAGTTGAGCGGACCGG
ATCCCATGTGGAGAGACGTGCTCAACTCGCATCAGTCGCGACCATTTCATGTCATGATTGGAGGTGGCGACCAAA
TTTACAATGACCGCCTCGCGTACAACAGTCCTCTGTTTGACGATTGGCTGGAAGAGAGAGATGCACACGAGAAGC
GTAACGCACCTTTTAGCGCAGCAATGCAGGATGAGCTTGAGGCTTTTTACTTGGAGCGATATTGCACATGGTTCT
CTCAGGGCCTCTTTGGCCTGGCCGTTTCCCAGATACCCATGGTCAACATGTACGACAACCATGACGTTTTTGACG
GCTATGGCTCCTACCCGCACCTCAACATGGCCTCACCCGTCTTTTGTGGACTCGGGGCTGTGGCATTCAAATACT
ATATGCTCTTTCAACATCAGAGCCTGGTAACGGAAACTGAAAAGTCGGAGCCAAGCTGGATCTTGAGTCTGGAGC
CCGGCCCGTACATCAAGGAGCTCAGTCACAGCATATACGTGTCTCTGGGAGGCAAAGTGGCACTGTTGGCTGTCG
ACTGTCGCACTGAGAGAACCGAGTCCGAGGTTGTTCGAGAGAAGACGTGGGAAAGGATTATGAATCGCATGTACT
CGGAGATTAGACGGGGGCAGATGGAGCATCTCTTATTGGTTTTGGGAACGCCCATTGCCTATCCTCGTCTGGTCT
GGCTGGAGAATATGTGAGTAGTGGTGCTGGCGCTGTGCAACAGAGGGTGTTTGTTGACACTTGCTAACAACTATG
TACACAGTTTGACATCAAGGCTCATGGGTCCGGTCAAGGCTTTGGGCAAAACGGGCATGCTAGGCAAAGCCATGA
ATGATATTGACGGCGGCGCCGACGCGCGAGATGACCTGAACGAGCACTGGACGGCCAAGAAGCACAAGCAGGAAC
GAAGTCTTGTTATCGAAGACTTGCAGGATCTGGCCATTGACAAGTCTTTGCGCATCACAATTCTAAGGTAGGGCA
AGATGGGCACTTGATTTGTATATTACTACTAACAGATTTTTTAATAGCGGCGACGTGCACATGGCGGCCGTTGGA
CAATTCTTCTCGTCTCCCAAGCTTGGCTTACCAAAACACAAGGATCCGCGGTATATGCCCAACGTGATTGCATCT
CCAATGGCGAATGCGCCACCTTCAGATTTCATGGCCGACGTGATCAATAAGCGGAACAAGGTGCACCATTTCGAT
AAGCAGACGGACGAAAACATGATTCCCCTCTTCCGGCACGGGGTGGATGGCAAAGTAAGGAATAACCCGCACTTA
CTGCCGCATAGAAACTGGTGCTCGATTAGCCTGTGGACGCCAGGCAGCACACCGCCCCCAACGCCACCGCGTTCC
TCGTACGAGGAGCGCCACAGCCCCTCGCCTCATGCAAACAGCAGCGGCGGCCTGCTGAGAAGATTGTCTTCACGG
CGCAAGTCGGCGCCACGGCGCATCGAGGGCGCTCACGAGTCGGTTCGAGGGCCTCGACCACCTATATCAGGCGGC
ATGGGCTTCTTCCAAAATATATCGCGGCGGCTATCTTGGTCAGACGGACAAGGTCTCACGCGCACCATGTCGCTG
GGCCGCGGAGAGGGCAGGGATAGAGGATACTTGAACTATGCCTACAGAAACAGCGAGAGCCAGCCCGGGGCCGAC
GAAGCAGACCTGCATGGCCAATGGCACACTGATGACTACGAGGGCCTTGGACCGGCTCCTGCGCGCACCCCCTTG
CGCCCTTCTGGCTTGCGCGGCGGCGCCCTGCACGACGAGTACAAGGAGGACGACGAATCCTACTTTAGCGCCTCG
CACCCGGCCCGCCTTGCCCAGACCATGGACAGTCTGCCCGCAGCAACGACGCATCGTGCCGACTCGCCCCCGCGC
CGCGCCTTTCACCGTACGCCAACCAACCTCTCGGCCAAACAGCTGCGCCAGTCGGAGCGCTTCCAAGTCGACGTT
GAAGGCGCGCTCGAGGTGGTGCTCAACATTGAGGTGAGCCCGCGCGACCCTGCTGGCATCACGGTGCCCTACCGT
CTGCTGGTGCCTCGTCTGCAGTACGAGTATAACCCGTCGGAAGACGACATTGCCCTCAAGGAACAAGCCGAGGGA
AGCGCGTTGAAGCGGCTGCTTGGCTTGGGGAAACGGACAGAAAAGGTGCGGTGCTACGAGCTCGAGGGCGCCGAG
ACGGACGAGGCGGTGCATGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail