Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6328
Gene name
LocationContig_57:66882..68772
Strand+
Gene length (bp)1890
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07534 TLD TLD 1.5E-29 363 557
PF08593 DUF1773 Domain of unknown function 2.1E-10 303 354

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E3QLU5|RTC5_COLGM Restriction of telomere capping protein 5 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=RTC5 PE=3 SV=1 1 611 0.0E+00
sp|A4RI88|RTC5_MAGO7 Restriction of telomere capping protein 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RTC5 PE=3 SV=1 1 612 0.0E+00
sp|Q7S454|RTC5_NEUCR Restriction of telomere capping protein 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rtc5 PE=3 SV=2 1 611 0.0E+00
sp|D1ZRF1|RTC5_SORMK Restriction of telomere capping protein 5 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=RTC5 PE=3 SV=1 1 568 0.0E+00
sp|C7YJ03|RTC5_NECH7 Restriction of telomere capping protein 5 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RTC5 PE=3 SV=1 1 611 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E3QLU5|RTC5_COLGM Restriction of telomere capping protein 5 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=RTC5 PE=3 SV=1 1 611 0.0E+00
sp|A4RI88|RTC5_MAGO7 Restriction of telomere capping protein 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RTC5 PE=3 SV=1 1 612 0.0E+00
sp|Q7S454|RTC5_NEUCR Restriction of telomere capping protein 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rtc5 PE=3 SV=2 1 611 0.0E+00
sp|D1ZRF1|RTC5_SORMK Restriction of telomere capping protein 5 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=RTC5 PE=3 SV=1 1 568 0.0E+00
sp|C7YJ03|RTC5_NECH7 Restriction of telomere capping protein 5 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RTC5 PE=3 SV=1 1 611 0.0E+00
sp|E4ZUJ1|RTC5_LEPMJ Restriction of telomere capping protein 5 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=RTC5 PE=3 SV=1 1 611 1.0E-164
sp|E3RYW5|RTC5_PYRTT Restriction of telomere capping protein 5 OS=Pyrenophora teres f. teres (strain 0-1) GN=rtc5 PE=3 SV=1 1 611 7.0E-143
sp|B2WB15|RTC5_PYRTR Restriction of telomere capping protein 5 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rtc5 PE=3 SV=1 8 611 2.0E-126
sp|Q2UGP9|RTC5_ASPOR Restriction of telomere capping protein 5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rtc5 PE=3 SV=1 1 611 1.0E-74
sp|B8N9M5|RTC5_ASPFN Restriction of telomere capping protein 5 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rtc5 PE=3 SV=1 1 611 1.0E-74
sp|B6QHL1|RTC5_TALMQ Restriction of telomere capping protein 5 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rtc5 PE=3 SV=1 16 611 2.0E-73
sp|Q5B6J2|RTC5_EMENI Restriction of telomere capping protein 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rtc5 PE=3 SV=1 16 609 3.0E-73
sp|B8MJJ8|RTC5_TALSN Restriction of telomere capping protein 5 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=rtc5 PE=3 SV=1 14 611 4.0E-73
sp|A1CXG7|RTC5_NEOFI Restriction of telomere capping protein 5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rtc5 PE=3 SV=1 1 611 1.0E-72
sp|Q4WP54|RTC5_ASPFU Restriction of telomere capping protein 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rtc5 PE=3 SV=2 1 611 2.0E-70
sp|B0Y601|RTC5_ASPFC Restriction of telomere capping protein 5 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rtc5 PE=3 SV=1 1 611 2.0E-70
sp|D4DDJ7|RTC5_TRIVH Restriction of telomere capping protein 5 OS=Trichophyton verrucosum (strain HKI 0517) GN=RTC5 PE=3 SV=1 14 603 3.0E-70
sp|A1CHC0|RTC5_ASPCL Restriction of telomere capping protein 5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rtc5 PE=3 SV=1 1 611 1.0E-69
sp|D4AVK1|RTC5_ARTBC Restriction of telomere capping protein 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=RTC5 PE=3 SV=1 14 603 6.0E-69
sp|B6H464|RTC5_PENRW Restriction of telomere capping protein 5 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rtc5 PE=3 SV=1 1 603 8.0E-69
sp|C5FSR3|RTC5_ARTOC Restriction of telomere capping protein 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=RTC5 PE=3 SV=1 2 605 1.0E-67
sp|A2QI73|RTC5_ASPNC Restriction of telomere capping protein 5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rtc5 PE=3 SV=1 2 602 3.0E-67
sp|E4UPA0|RTC5_ARTGP Restriction of telomere capping protein 5 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=RTC5 PE=3 SV=1 2 603 4.0E-67
sp|C1GYL0|RTC5_PARBA Restriction of telomere capping protein 5 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=RTC5 PE=3 SV=1 1 609 1.0E-62
sp|C4R3K5|RTC5_PICPG Restriction of telomere capping protein 5 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=RTC5 PE=3 SV=1 1 611 2.0E-62
sp|C5P441|RTC5_COCP7 Restriction of telomere capping protein 5 OS=Coccidioides posadasii (strain C735) GN=RTC5 PE=3 SV=1 12 603 2.0E-60
sp|C0RYV6|RTC5_PARBP Restriction of telomere capping protein 5 OS=Paracoccidioides brasiliensis (strain Pb03) GN=RTC5 PE=3 SV=1 1 609 4.0E-60
sp|C5GFG2|RTC5_AJEDR Restriction of telomere capping protein 5 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=RTC5 PE=3 SV=1 1 603 4.0E-60
sp|C5JIS5|RTC5_AJEDS Restriction of telomere capping protein 5 OS=Ajellomyces dermatitidis (strain SLH14081) GN=RTC5 PE=3 SV=1 1 603 4.0E-60
sp|C1G788|RTC5_PARBD Restriction of telomere capping protein 5 OS=Paracoccidioides brasiliensis (strain Pb18) GN=RTC5 PE=3 SV=1 1 609 6.0E-59
sp|Q6CB30|RTC5_YARLI Restriction of telomere capping protein 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RTC5 PE=3 SV=1 1 611 2.0E-57
sp|C4JHR8|RTC5_UNCRE Restriction of telomere capping protein 5 OS=Uncinocarpus reesii (strain UAMH 1704) GN=RTC5 PE=3 SV=1 12 603 3.0E-56
sp|A6RBC0|RTC5_AJECN Restriction of telomere capping protein 5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RTC5 PE=3 SV=1 1 603 5.0E-55
sp|C6H208|RTC5_AJECH Restriction of telomere capping protein 5 OS=Ajellomyces capsulatus (strain H143) GN=RTC5 PE=3 SV=1 1 603 3.0E-54
sp|C4Y146|RTC5_CLAL4 Restriction of telomere capping protein 5 OS=Clavispora lusitaniae (strain ATCC 42720) GN=RTC5 PE=3 SV=1 76 611 8.0E-50
sp|C5DJG1|RTC5_LACTC Restriction of telomere capping protein 5 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RTC5 PE=3 SV=1 76 611 1.0E-48
sp|Q6CMD3|RTC5_KLULA Restriction of telomere capping protein 5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RTC5 PE=3 SV=1 199 611 7.0E-48
sp|Q6FKH1|RTC5_CANGA Restriction of telomere capping protein 5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RTC5 PE=3 SV=1 281 611 4.0E-47
sp|A3LQG3|RTC5_PICST Restriction of telomere capping protein 5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RTC5 PE=3 SV=2 73 611 8.0E-47
sp|C5DY36|RTC5_ZYGRC Restriction of telomere capping protein 5 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RTC5 PE=3 SV=1 1 611 3.0E-45
sp|A5DMB8|RTC5_PICGU Restriction of telomere capping protein 5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RTC5 PE=3 SV=2 1 611 9.0E-45
sp|Q12108|RTC5_YEAST Restriction of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC5 PE=1 SV=1 76 611 1.0E-43
sp|C8ZI80|RTC5_YEAS8 Restriction of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RTC5 PE=3 SV=1 76 611 1.0E-43
sp|C7GML8|RTC5_YEAS2 Restriction of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain JAY291) GN=RTC5 PE=3 SV=1 76 611 1.0E-43
sp|B3LJG1|RTC5_YEAS1 Restriction of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RTC5 PE=3 SV=1 76 611 1.0E-43
sp|Q6BHX4|RTC5_DEBHA Restriction of telomere capping protein 5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RTC5 PE=3 SV=2 82 609 2.0E-43
sp|Q756J6|RTC5_ASHGO Restriction of telomere capping protein 5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RTC5 PE=3 SV=2 69 611 3.0E-43
sp|A6ZNW6|RTC5_YEAS7 Restriction of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain YJM789) GN=RTC5 PE=3 SV=1 76 611 4.0E-43
sp|A7TNS4|RTC5_VANPO Restriction of telomere capping protein 5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RTC5 PE=3 SV=1 181 611 4.0E-42
sp|C5MCY0|RTC5_CANTT Restriction of telomere capping protein 5 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RTC5 PE=3 SV=1 1 609 1.0E-41
sp|A5DSQ8|RTC5_LODEL Restriction of telomere capping protein 5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RTC5 PE=3 SV=1 364 611 3.0E-37
sp|O94644|RTC5_SCHPO Restriction of telomere capping protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtc5 PE=3 SV=1 217 555 3.0E-22
sp|B6K4Q8|RTC5_SCHJY Restriction of telomere capping protein 5 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rtc5 PE=3 SV=1 204 555 3.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6328
MGQALSDEQPRRRSHDQLAHELACKFKDKCFTSLEFYSLKDVFKSLADQQGSVRYLKEDTVARYLEIPDILGASP
VVFQMVSYLGAFPFLHDAPVIVELSRLIMVIVIMTDRFRRVLAKGSSDRAKLFFKSLAVYDRKASDAHGSMPNPK
VHHDGKSQSQGFAIDAPRGSTGDSNDDDDIDQFGVEEDDLVLTAYELLDVTEAVRQGSYPDHHDAMIPTDNFRRL
LLLLLLAAPLDAQESLSQYSNRVSGQPLEQLRSVAENMLASFVDAETSPGVRYRQFKTVIPVLFPNLFHSFNGLF
ERFLFSSNLDFSKHKGPPGNGQDQRQRAAQPLLRDRADILNDHILSQISMFIPGSSLFHRVRLLYSGSQAGFSTG
SFQSKVFNWRAPTILVVSGTRLDSVPNGGQETSFADSLPPNHFSAGSKSDRVTFGVYLREPWKHTHKTCFGSSET
ILFQLEPVHDVFPASTINTDYVAFTKPPGNQPCLSFGCPHPRPTQSQRKDGIFSLGAVSLLLNDSFEFGVFNHDY
RSRGGAFHTSIVRKFDFQDRFQIDNLEVWGCGDDAEAKAQAERWAWEEREAEARRKINLGTGDIEADRALLEMAG
LVGANRSGGSVL*
Coding >OphauB2|6328
ATGGGCCAGGCCTTGTCCGACGAGCAGCCGCGCCGGCGGTCCCACGACCAGCTGGCGCATGAGCTCGCTTGCAAG
TTCAAAGACAAATGCTTCACCTCACTCGAGTTTTACTCCCTCAAAGATGTCTTCAAGAGTCTGGCCGACCAGCAG
GGCTCCGTGCGCTACCTCAAGGAGGACACCGTGGCCCGCTATCTCGAGATTCCCGACATTCTCGGCGCGTCGCCC
GTCGTCTTCCAAATGGTTTCCTATCTTGGTGCTTTCCCCTTCCTTCATGATGCTCCAGTAATTGTCGAACTGTCT
CGCCTCATCATGGTGATTGTCATCATGACGGATCGCTTCCGACGTGTACTCGCAAAGGGCTCCTCGGATAGAGCC
AAGCTGTTCTTCAAGAGTCTTGCTGTATACGATCGCAAGGCATCCGACGCTCATGGTTCCATGCCCAATCCCAAG
GTGCACCATGATGGCAAGTCGCAGAGTCAGGGCTTCGCAATTGATGCTCCACGAGGTAGTACAGGCGACAGCAAC
GACGATGACGACATCGATCAATTTGGCGTCGAGGAAGATGACCTTGTCTTGACGGCATACGAGCTTCTTGATGTG
ACAGAGGCTGTTCGCCAAGGCAGCTATCCTGATCATCACGATGCCATGATACCAACGGACAATTTCCGACGACTT
CTTTTGTTGCTCCTGCTCGCCGCTCCACTCGACGCACAAGAGAGCCTTTCGCAGTACTCAAATCGCGTTTCCGGG
CAGCCTTTGGAGCAATTACGCTCGGTGGCCGAGAACATGCTTGCCTCGTTTGTCGATGCTGAGACATCGCCCGGT
GTCCGCTACCGCCAATTCAAGACCGTGATTCCAGTGCTATTTCCCAATCTCTTTCATAGTTTTAATGGCTTGTTT
GAACGCTTCCTATTTTCTTCCAACCTAGACTTTTCAAAACACAAAGGCCCGCCAGGCAATGGCCAAGACCAGCGC
CAAAGGGCCGCACAACCCCTATTGAGAGACAGGGCCGACATCCTCAACGACCATATTTTGTCTCAAATATCCATG
TTCATTCCGGGATCATCACTCTTCCACCGCGTCAGACTCCTTTATTCTGGCAGTCAGGCTGGCTTCTCGACTGGC
AGCTTCCAGTCCAAGGTCTTCAATTGGAGAGCACCAACGATACTCGTCGTCAGCGGAACGCGCCTCGACAGCGTG
CCCAACGGTGGCCAGGAGACGTCGTTTGCAGATTCGCTACCTCCTAACCACTTCTCGGCCGGAAGCAAATCAGAC
CGGGTCACCTTTGGTGTCTATCTGCGGGAACCATGGAAACACACGCACAAAACGTGTTTTGGAAGCTCCGAGACG
ATCCTCTTCCAACTCGAACCCGTTCACGACGTATTTCCAGCCTCAACCATTAATACCGACTATGTTGCCTTTACA
AAGCCTCCGGGAAACCAGCCATGCCTCTCGTTTGGCTGCCCGCATCCAAGGCCCACCCAGTCGCAGCGCAAAGAT
GGCATTTTCTCGCTTGGCGCTGTGTCGCTTCTCCTCAACGACTCGTTCGAGTTTGGCGTTTTTAACCACGACTAC
AGGTCGCGCGGCGGAGCATTTCACACGAGCATTGTGAGAAAGTTTGACTTTCAAGATCGTTTCCAAATCGACAAC
CTCGAGGTTTGGGGCTGCGGCGACGATGCCGAGGCCAAGGCACAAGCTGAGAGATGGGCGTGGGAAGAGAGGGAA
GCAGAAGCTCGACGCAAAATTAATCTCGGAACCGGGGATATTGAGGCTGATCGGGCATTGCTGGAAATGGCTGGA
CTTGTTGGGGCCAATCGTAGCGGCGGATCCGTGCTTTGA
Transcript >OphauB2|6328
ATGGGCCAGGCCTTGTCCGACGAGCAGCCGCGCCGGCGGTCCCACGACCAGCTGGCGCATGAGCTCGCTTGCAAG
TTCAAAGACAAATGCTTCACCTCACTCGAGTTTTACTCCCTCAAAGATGTCTTCAAGAGTCTGGCCGACCAGCAG
GGCTCCGTGCGCTACCTCAAGGAGGACACCGTGGCCCGCTATCTCGAGATTCCCGACATTCTCGGCGCGTCGCCC
GTCGTCTTCCAAATGGTTTCCTATCTTGGTGCTTTCCCCTTCCTTCATGATGCTCCAGTAATTGTCGAACTGTCT
CGCCTCATCATGGTGATTGTCATCATGACGGATCGCTTCCGACGTGTACTCGCAAAGGGCTCCTCGGATAGAGCC
AAGCTGTTCTTCAAGAGTCTTGCTGTATACGATCGCAAGGCATCCGACGCTCATGGTTCCATGCCCAATCCCAAG
GTGCACCATGATGGCAAGTCGCAGAGTCAGGGCTTCGCAATTGATGCTCCACGAGGTAGTACAGGCGACAGCAAC
GACGATGACGACATCGATCAATTTGGCGTCGAGGAAGATGACCTTGTCTTGACGGCATACGAGCTTCTTGATGTG
ACAGAGGCTGTTCGCCAAGGCAGCTATCCTGATCATCACGATGCCATGATACCAACGGACAATTTCCGACGACTT
CTTTTGTTGCTCCTGCTCGCCGCTCCACTCGACGCACAAGAGAGCCTTTCGCAGTACTCAAATCGCGTTTCCGGG
CAGCCTTTGGAGCAATTACGCTCGGTGGCCGAGAACATGCTTGCCTCGTTTGTCGATGCTGAGACATCGCCCGGT
GTCCGCTACCGCCAATTCAAGACCGTGATTCCAGTGCTATTTCCCAATCTCTTTCATAGTTTTAATGGCTTGTTT
GAACGCTTCCTATTTTCTTCCAACCTAGACTTTTCAAAACACAAAGGCCCGCCAGGCAATGGCCAAGACCAGCGC
CAAAGGGCCGCACAACCCCTATTGAGAGACAGGGCCGACATCCTCAACGACCATATTTTGTCTCAAATATCCATG
TTCATTCCGGGATCATCACTCTTCCACCGCGTCAGACTCCTTTATTCTGGCAGTCAGGCTGGCTTCTCGACTGGC
AGCTTCCAGTCCAAGGTCTTCAATTGGAGAGCACCAACGATACTCGTCGTCAGCGGAACGCGCCTCGACAGCGTG
CCCAACGGTGGCCAGGAGACGTCGTTTGCAGATTCGCTACCTCCTAACCACTTCTCGGCCGGAAGCAAATCAGAC
CGGGTCACCTTTGGTGTCTATCTGCGGGAACCATGGAAACACACGCACAAAACGTGTTTTGGAAGCTCCGAGACG
ATCCTCTTCCAACTCGAACCCGTTCACGACGTATTTCCAGCCTCAACCATTAATACCGACTATGTTGCCTTTACA
AAGCCTCCGGGAAACCAGCCATGCCTCTCGTTTGGCTGCCCGCATCCAAGGCCCACCCAGTCGCAGCGCAAAGAT
GGCATTTTCTCGCTTGGCGCTGTGTCGCTTCTCCTCAACGACTCGTTCGAGTTTGGCGTTTTTAACCACGACTAC
AGGTCGCGCGGCGGAGCATTTCACACGAGCATTGTGAGAAAGTTTGACTTTCAAGATCGTTTCCAAATCGACAAC
CTCGAGGTTTGGGGCTGCGGCGACGATGCCGAGGCCAAGGCACAAGCTGAGAGATGGGCGTGGGAAGAGAGGGAA
GCAGAAGCTCGACGCAAAATTAATCTCGGAACCGGGGATATTGAGGCTGATCGGGCATTGCTGGAAATGGCTGGA
CTTGTTGGGGCCAATCGTAGCGGCGGATCCGTGCTTTGA
Gene >OphauB2|6328
ATGGGCCAGGCCTTGTCCGACGAGCAGCCGCGCCGGCGGTCCCACGACCAGCTGGCGCATGAGCTCGTGAGCTGA
TACTCCTTTGGATCCGACGCAAGCTGACACTTGTGATGGCAGGCTTGCAAGTTCAAAGACAAATGCTTCACCTCA
CTCGAGTTTTACTCCCTCAAAGATGTCTTCAAGAGTCTGGCCGACCAGCAGGGCTCCGTGCGCTACCTCAAGGAG
GACACCGTGGCCCGCTATCTCGAGATTCCCGACATTCTCGGCGCGTCGCCCGTCGTCTTCCAAATGGTTTCCTAT
CTTGGTGCTTTCCCCTTCCTTCATGATGCTCCAGTAATTGTCGAACTGTCTCGCCTCATCATGGTGATTGTCATC
ATGACGGATCGCTTCCGACGTGTACTCGCAAAGGGCTCCTCGGATAGAGCCAAGCTGTTCTTCAAGAGTCTTGCT
GTATACGATCGCAAGGCATCCGACGCTCATGGTTCCATGCCCAATCCCAAGGTGCACCATGATGGCAAGTCGCAG
AGTCAGGGCTTCGCAATTGATGCTCCACGAGGTAGTACAGGCGACAGCAACGACGATGACGACATCGATCAATTT
GGCGTCGAGGAAGATGACCTTGTCTTGACGGCATACGAGCTTCTTGATGTGACAGAGGCTGTTCGCCAAGGCAGC
TATCCTGATCATCACGATGCCATGATACCAACGGACAATTTCCGACGACTTCTTTTGTTGCTCCTGCTCGCCGCT
CCACTCGACGCACAAGAGAGCCTTTCGCAGTACTCAAATCGCGTTTCCGGGCAGCCTTTGGAGCAATTACGCTCG
GTGGCCGAGAACATGCTTGCCTCGTTTGTCGATGCTGAGACATCGCCCGGTGTCCGCTACCGCCAATTCAAGACC
GTGATTCCAGTGCTATTTCCCAATCTCTTTCATAGTTTTAATGGCTTGTTTGAACGCTTCCTATTTTCTTCCAAC
CTAGACTTTTCAAAACACAAAGGCCCGCCAGGCAATGGCCAAGACCAGCGCCAAAGGGCCGCACAACCCCTATTG
AGAGACAGGGCCGACATCCTCAACGACCATATTTTGTCTCAAATATCCATGTTCATTCCGGGATCATCACTCTTC
CACCGCGTCAGACTCCTTTATTCTGGCAGTCAGGCTGGCTTCTCGACTGGCAGCTTCCAGTCCAAGGTCTTCAAT
TGGAGAGCACCAACGATACTCGTCGTCAGCGGAACGCGCCTCGACAGCGTGCCCAACGGTGGCCAGGAGACGTCG
TTTGCAGATTCGCTACCTCCTAACCACTTCTCGGCCGGAAGCAAATCAGACCGGGTCACCTTTGGTGTCTATCTG
CGGGAACCATGGAAACACACGCACAAAACGTGTTTTGGAAGCTCCGAGACGATCCTCTTCCAACTCGAACCCGTT
CACGACGTATTTCCAGCCTCAACCATTAATACCGACTATGTTGCCTTTACAAAGCCTCCGGGAAACCAGCCATGC
CTCTCGTTTGGCTGCCCGCATCCAAGGCCCACCCAGTCGCAGCGCAAAGATGGCATTTTCTCGCTTGGCGCTGTG
TCGCTTCTCCTCAACGACTCGTTCGAGTTTGGCGTTTTTAACCACGACTACAGGTCGCGCGGCGGAGCATTTCAC
ACGAGCATTGTGAGAAAGTTTGACTTTCAAGATCGTTTCCAAATCGACAACCTCGAGGTTTGGGGCTGCGGCGAC
GATGCCGAGGCCAAGGCACAAGCTGAGAGATGGGCGTGGGAAGAGAGGGAAGCAGAAGCTCGACGCAAAATTAAT
CTCGGAACCGGGGATATTGAGGCTGATCGGGCATTGCTGGAAATGGCTGGACTTGTTGGGGCCAATCGTAGCGGC
GGATCCGTGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail