Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6327
Gene name
LocationContig_57:63521..65469
Strand-
Gene length (bp)1948
Transcript length (bp)1884
Coding sequence length (bp)1884
Protein length (aa) 628

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 4.9E-10 66 408

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40986|CDC1_YEAST Cell division control protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC1 PE=1 SV=2 29 492 1.0E-58
sp|Q9UUH0|YKIC_SCHPO Uncharacterized protein C630.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC630.12 PE=3 SV=1 27 495 2.0E-48

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 20 37 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6327
MIFAMRTLHQIRRNLTRRRLLSFPHALVLIWMLVLLRGERWTFESSVSECAWHNWEKWPKDANPHHLVLIADPQL
IDPHSYPSRPWPLSALTVLITDKYMQRSYVALQRQLRPDSVFFLGDLFDGGREWKTRRGTRFVDPKWGTDRSGEE
KKWVSTWHRRYGQDFWLREYMRFGRIFVDNWSLGGNTPGPWQRGRKLVASLPGNHDIGFGAQVQLPVRDRFSAFF
GDVNRVDIVGNHSIVTVDAVSLGADTSAYKNSHDLRPIYGPVNEFLDNVQAIKRRAAQTELSVWHDTVEHPVERF
PHKVEGVAATTKEAETAHVQGPDLPTILLTHVPLYRDPGTPCGPHREHWPPSKPPKRQSDMVQPDLRNAITVAAG
YQYQNVLSEEDSVKLVRKVGNVVHVFSGDDHDYCELKHSAAKNGVREITIKSFSMAMGVPTPGFLMVSLWNPVDD
DGRPLAPETGPTLQTHLCLLPKQLHTYVRYAALIVVSLAMLAVRALLVPVLHISPFALEPEPASTQILPLSETRL
ASWISGGEKAKKDPPDYGRMHPSAAAASSGTARWAAKKSGRRDRGGLRIKLDDDFYEGAKAWKRGRVLGIGSLGQ
WLQEMWTTTWRVAWMTVLFWIYLARGE*
Coding >OphauB2|6327
ATGATCTTTGCAATGAGGACGCTTCACCAGATTCGCCGTAATTTAACTAGGCGGCGTCTCCTGAGCTTTCCACAC
GCCTTGGTGCTCATTTGGATGTTGGTTTTGCTCAGAGGAGAACGTTGGACATTTGAAAGCAGTGTTTCCGAGTGC
GCATGGCACAATTGGGAGAAGTGGCCCAAAGACGCGAATCCGCATCATCTTGTTTTAATTGCCGATCCGCAACTC
ATCGATCCGCACTCATACCCAAGTCGGCCGTGGCCGCTATCTGCATTGACAGTTCTCATTACCGACAAGTACATG
CAGCGGAGCTATGTGGCGCTGCAGCGGCAGCTTCGGCCAGACAGCGTCTTCTTCCTCGGCGATCTCTTTGACGGC
GGGCGCGAGTGGAAAACGCGTCGGGGGACGCGCTTCGTTGATCCCAAATGGGGCACCGATCGCTCAGGCGAAGAG
AAGAAATGGGTTTCTACGTGGCACCGCAGATACGGCCAGGACTTTTGGCTGCGCGAATACATGAGGTTTGGCCGC
ATATTCGTCGACAACTGGAGCCTCGGTGGCAACACGCCTGGCCCATGGCAGAGGGGAAGGAAGCTCGTGGCCAGC
CTGCCGGGCAACCATGACATTGGATTTGGCGCCCAGGTTCAGCTTCCTGTTCGCGACCGCTTCAGCGCTTTTTTT
GGCGATGTCAATCGCGTCGATATTGTCGGCAACCATTCCATCGTGACTGTTGACGCCGTATCGCTGGGCGCAGAT
ACGTCGGCTTATAAGAATAGCCACGATTTGCGCCCCATATACGGCCCAGTCAACGAATTTCTTGACAACGTGCAA
GCTATCAAGAGACGAGCAGCCCAAACCGAACTAAGCGTCTGGCACGACACTGTGGAGCATCCCGTTGAACGATTT
CCACACAAAGTAGAAGGCGTGGCTGCGACAACAAAAGAGGCAGAGACTGCTCATGTGCAAGGACCAGACCTTCCC
ACAATACTACTCACCCACGTGCCTCTGTATCGCGATCCGGGCACGCCTTGTGGGCCACACCGTGAACACTGGCCG
CCCTCCAAACCGCCAAAACGACAGTCGGACATGGTGCAGCCAGATTTACGCAATGCAATTACTGTCGCGGCTGGC
TACCAGTATCAAAATGTGCTGAGCGAGGAAGACTCGGTCAAACTGGTGCGCAAAGTTGGCAACGTGGTGCATGTC
TTTTCGGGCGATGACCACGACTATTGCGAGTTGAAGCACTCGGCCGCTAAGAATGGCGTGCGCGAAATCACCATC
AAGAGCTTTAGCATGGCCATGGGTGTTCCCACGCCGGGATTCCTCATGGTGAGCCTCTGGAATCCAGTCGACGAC
GATGGTAGGCCACTGGCGCCAGAGACTGGGCCAACGCTGCAGACGCACTTGTGCCTACTGCCCAAGCAACTACAC
ACGTATGTCAGATACGCGGCTCTCATTGTCGTGTCTTTGGCAATGCTGGCTGTTCGTGCCCTGCTGGTGCCAGTA
TTACATATCTCGCCCTTTGCTCTCGAGCCGGAGCCCGCGTCGACTCAAATCCTGCCCTTGTCAGAGACACGCCTC
GCAAGCTGGATCTCTGGTGGCGAAAAAGCGAAAAAAGATCCACCCGACTATGGACGGATGCACCCAAGCGCCGCA
GCAGCATCGTCAGGCACGGCGCGATGGGCGGCAAAGAAGAGCGGGCGGCGCGATCGTGGCGGTCTGCGCATCAAG
CTCGATGACGACTTTTACGAAGGAGCTAAAGCGTGGAAAAGGGGAAGAGTCTTGGGAATCGGGTCGCTTGGGCAA
TGGCTACAGGAAATGTGGACGACTACGTGGAGAGTGGCATGGATGACGGTCTTGTTTTGGATCTATCTGGCAAGG
GGAGAATAA
Transcript >OphauB2|6327
ATGATCTTTGCAATGAGGACGCTTCACCAGATTCGCCGTAATTTAACTAGGCGGCGTCTCCTGAGCTTTCCACAC
GCCTTGGTGCTCATTTGGATGTTGGTTTTGCTCAGAGGAGAACGTTGGACATTTGAAAGCAGTGTTTCCGAGTGC
GCATGGCACAATTGGGAGAAGTGGCCCAAAGACGCGAATCCGCATCATCTTGTTTTAATTGCCGATCCGCAACTC
ATCGATCCGCACTCATACCCAAGTCGGCCGTGGCCGCTATCTGCATTGACAGTTCTCATTACCGACAAGTACATG
CAGCGGAGCTATGTGGCGCTGCAGCGGCAGCTTCGGCCAGACAGCGTCTTCTTCCTCGGCGATCTCTTTGACGGC
GGGCGCGAGTGGAAAACGCGTCGGGGGACGCGCTTCGTTGATCCCAAATGGGGCACCGATCGCTCAGGCGAAGAG
AAGAAATGGGTTTCTACGTGGCACCGCAGATACGGCCAGGACTTTTGGCTGCGCGAATACATGAGGTTTGGCCGC
ATATTCGTCGACAACTGGAGCCTCGGTGGCAACACGCCTGGCCCATGGCAGAGGGGAAGGAAGCTCGTGGCCAGC
CTGCCGGGCAACCATGACATTGGATTTGGCGCCCAGGTTCAGCTTCCTGTTCGCGACCGCTTCAGCGCTTTTTTT
GGCGATGTCAATCGCGTCGATATTGTCGGCAACCATTCCATCGTGACTGTTGACGCCGTATCGCTGGGCGCAGAT
ACGTCGGCTTATAAGAATAGCCACGATTTGCGCCCCATATACGGCCCAGTCAACGAATTTCTTGACAACGTGCAA
GCTATCAAGAGACGAGCAGCCCAAACCGAACTAAGCGTCTGGCACGACACTGTGGAGCATCCCGTTGAACGATTT
CCACACAAAGTAGAAGGCGTGGCTGCGACAACAAAAGAGGCAGAGACTGCTCATGTGCAAGGACCAGACCTTCCC
ACAATACTACTCACCCACGTGCCTCTGTATCGCGATCCGGGCACGCCTTGTGGGCCACACCGTGAACACTGGCCG
CCCTCCAAACCGCCAAAACGACAGTCGGACATGGTGCAGCCAGATTTACGCAATGCAATTACTGTCGCGGCTGGC
TACCAGTATCAAAATGTGCTGAGCGAGGAAGACTCGGTCAAACTGGTGCGCAAAGTTGGCAACGTGGTGCATGTC
TTTTCGGGCGATGACCACGACTATTGCGAGTTGAAGCACTCGGCCGCTAAGAATGGCGTGCGCGAAATCACCATC
AAGAGCTTTAGCATGGCCATGGGTGTTCCCACGCCGGGATTCCTCATGGTGAGCCTCTGGAATCCAGTCGACGAC
GATGGTAGGCCACTGGCGCCAGAGACTGGGCCAACGCTGCAGACGCACTTGTGCCTACTGCCCAAGCAACTACAC
ACGTATGTCAGATACGCGGCTCTCATTGTCGTGTCTTTGGCAATGCTGGCTGTTCGTGCCCTGCTGGTGCCAGTA
TTACATATCTCGCCCTTTGCTCTCGAGCCGGAGCCCGCGTCGACTCAAATCCTGCCCTTGTCAGAGACACGCCTC
GCAAGCTGGATCTCTGGTGGCGAAAAAGCGAAAAAAGATCCACCCGACTATGGACGGATGCACCCAAGCGCCGCA
GCAGCATCGTCAGGCACGGCGCGATGGGCGGCAAAGAAGAGCGGGCGGCGCGATCGTGGCGGTCTGCGCATCAAG
CTCGATGACGACTTTTACGAAGGAGCTAAAGCGTGGAAAAGGGGAAGAGTCTTGGGAATCGGGTCGCTTGGGCAA
TGGCTACAGGAAATGTGGACGACTACGTGGAGAGTGGCATGGATGACGGTCTTGTTTTGGATCTATCTGGCAAGG
GGAGAATAA
Gene >OphauB2|6327
ATGATCTTTGCAATGAGGACGCTTCACCAGATTCGCCGTAATTTAACTAGGCGGCGTCTCCTGAGCTTTCCACAC
GCCTTGGTGCTCATTTGGATGTTGGTTTTGCTCAGAGGAGAACGTTGGACATTTGAAAGCAGTGTTTCCGAGTGC
GCATGGCACAATTGGGAGAAGTGGGTAGGTTTACTGAAGCACTCCATCGCATTTGAAGATTGCTGACCTCGGCAT
CTGTCACGAGCAGCCCAAAGACGCGAATCCGCATCATCTTGTTTTAATTGCCGATCCGCAACTCATCGATCCGCA
CTCATACCCAAGTCGGCCGTGGCCGCTATCTGCATTGACAGTTCTCATTACCGACAAGTACATGCAGCGGAGCTA
TGTGGCGCTGCAGCGGCAGCTTCGGCCAGACAGCGTCTTCTTCCTCGGCGATCTCTTTGACGGCGGGCGCGAGTG
GAAAACGCGTCGGGGGACGCGCTTCGTTGATCCCAAATGGGGCACCGATCGCTCAGGCGAAGAGAAGAAATGGGT
TTCTACGTGGCACCGCAGATACGGCCAGGACTTTTGGCTGCGCGAATACATGAGGTTTGGCCGCATATTCGTCGA
CAACTGGAGCCTCGGTGGCAACACGCCTGGCCCATGGCAGAGGGGAAGGAAGCTCGTGGCCAGCCTGCCGGGCAA
CCATGACATTGGATTTGGCGCCCAGGTTCAGCTTCCTGTTCGCGACCGCTTCAGCGCTTTTTTTGGCGATGTCAA
TCGCGTCGATATTGTCGGCAACCATTCCATCGTGACTGTTGACGCCGTATCGCTGGGCGCAGATACGTCGGCTTA
TAAGAATAGCCACGATTTGCGCCCCATATACGGCCCAGTCAACGAATTTCTTGACAACGTGCAAGCTATCAAGAG
ACGAGCAGCCCAAACCGAACTAAGCGTCTGGCACGACACTGTGGAGCATCCCGTTGAACGATTTCCACACAAAGT
AGAAGGCGTGGCTGCGACAACAAAAGAGGCAGAGACTGCTCATGTGCAAGGACCAGACCTTCCCACAATACTACT
CACCCACGTGCCTCTGTATCGCGATCCGGGCACGCCTTGTGGGCCACACCGTGAACACTGGCCGCCCTCCAAACC
GCCAAAACGACAGTCGGACATGGTGCAGCCAGATTTACGCAATGCAATTACTGTCGCGGCTGGCTACCAGTATCA
AAATGTGCTGAGCGAGGAAGACTCGGTCAAACTGGTGCGCAAAGTTGGCAACGTGGTGCATGTCTTTTCGGGCGA
TGACCACGACTATTGCGAGTTGAAGCACTCGGCCGCTAAGAATGGCGTGCGCGAAATCACCATCAAGAGCTTTAG
CATGGCCATGGGTGTTCCCACGCCGGGATTCCTCATGGTGAGCCTCTGGAATCCAGTCGACGACGATGGTAGGCC
ACTGGCGCCAGAGACTGGGCCAACGCTGCAGACGCACTTGTGCCTACTGCCCAAGCAACTACACACGTATGTCAG
ATACGCGGCTCTCATTGTCGTGTCTTTGGCAATGCTGGCTGTTCGTGCCCTGCTGGTGCCAGTATTACATATCTC
GCCCTTTGCTCTCGAGCCGGAGCCCGCGTCGACTCAAATCCTGCCCTTGTCAGAGACACGCCTCGCAAGCTGGAT
CTCTGGTGGCGAAAAAGCGAAAAAAGATCCACCCGACTATGGACGGATGCACCCAAGCGCCGCAGCAGCATCGTC
AGGCACGGCGCGATGGGCGGCAAAGAAGAGCGGGCGGCGCGATCGTGGCGGTCTGCGCATCAAGCTCGATGACGA
CTTTTACGAAGGAGCTAAAGCGTGGAAAAGGGGAAGAGTCTTGGGAATCGGGTCGCTTGGGCAATGGCTACAGGA
AATGTGGACGACTACGTGGAGAGTGGCATGGATGACGGTCTTGTTTTGGATCTATCTGGCAAGGGGAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail