Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6314
Gene name
LocationContig_57:36019..38665
Strand+
Gene length (bp)2646
Transcript length (bp)2646
Coding sequence length (bp)2646
Protein length (aa) 882

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00569 ZZ Zinc finger, ZZ type 5.7E-10 150 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q24629|REF2P_DROSI Protein ref(2)P OS=Drosophila simulans GN=ref(2)P PE=3 SV=1 147 216 6.0E-09
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 150 202 2.0E-08
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 150 202 2.0E-08
sp|P14199|REF2P_DROME Protein ref(2)P OS=Drosophila melanogaster GN=ref(2)P PE=1 SV=2 147 216 7.0E-08
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 148 202 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q24629|REF2P_DROSI Protein ref(2)P OS=Drosophila simulans GN=ref(2)P PE=3 SV=1 147 216 6.0E-09
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 150 202 2.0E-08
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 150 202 2.0E-08
sp|P14199|REF2P_DROME Protein ref(2)P OS=Drosophila melanogaster GN=ref(2)P PE=1 SV=2 147 216 7.0E-08
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 148 202 1.0E-07
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 148 202 4.0E-07
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 148 202 4.0E-07
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 148 202 5.0E-07
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 148 202 7.0E-07
sp|Q16981|NCS1_APLCA Neuronal calcium sensor 1 OS=Aplysia californica PE=2 SV=2 291 356 1.0E-06
sp|Q5R6S5|HPCL4_PONAB Hippocalcin-like protein 4 OS=Pongo abelii GN=HPCAL4 PE=2 SV=3 299 367 5.0E-06
sp|Q9UM19|HPCL4_HUMAN Hippocalcin-like protein 4 OS=Homo sapiens GN=HPCAL4 PE=1 SV=3 299 367 5.0E-06
sp|P29104|HPCL4_BOVIN Hippocalcin-like protein 4 OS=Bos taurus GN=HPCAL4 PE=1 SV=3 299 367 5.0E-06
sp|Q8BGZ1|HPCL4_MOUSE Hippocalcin-like protein 4 OS=Mus musculus GN=Hpcal4 PE=1 SV=3 299 367 5.0E-06
sp|P35332|HPCL4_RAT Hippocalcin-like protein 4 OS=Rattus norvegicus GN=Hpcal4 PE=2 SV=2 299 367 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6314
MWPPTTSSMSSDTLLRPRVAAVMVAAAACLSFGYYYGFSQGSWEMFTNSLFGSATRLHRSNATRRPRRLRRDAAL
RAMSASSSSSSDEGEDIENQPNISSQDLDNLMDINMGDWWLDPPNEYASSQRAGHNIVNLLFRVSEDNAKRNGYI
HRGCQCNACGAVPIRGVRYRCSNCSDFDLCETCEAHAMHHKTHIFYKIRVPAPPFGPRQIQPVWYTGDPSPSASN
LSRQLITRFSAITSFERPELEAFWEQWTFMANTEWREDPDELYLAMDRKTFERCLVPTGGSRHTPPNLIHDRMFA
FYDTNNDGLIGFGEFLQGLTYRKRQDKLNKIFEGYDIDSDGLVSRLDFLRMFRAYYVLYKQMHKDILDGLQDQII
ASVEAQHLVASRQPISALFGRDSSLPRADRPRPLVGKTMHLDGSIEVEESFRQPTVADKPDTASRNEILTSLFAY
GVQNLSHRRLILGRDFDSNWRSINRLAGLDDERNRAYIMSVLDPPSNLDQLASTLSGNNDGNRHNTPEGDEVDDE
SDEQGGVSLSQTSASAVDRRNSSTTSARLGRRPPDGQGRTYDPERARRELARHRLHQRWSRRDFYLDVEEGGEPP
EDWNNDEDILAQVMQAAQDVATAAQPCSTETQTAPQSRPQTEGVHYNNVTAPSAISPLDNGPEQSTAFEIPDAER
DAGKEILYQVTQQAFNELLDIIFQEAEELAFEAAETKDIRERYRAQIEALDSSGTQEGNVEAPASSGVFMDEGLE
QERGEAEAGEHHQTFVSLDSVDVVETSSQQDRFGFQDGEEYRDPTMPQFRPNITPEPAPMNEAQHHEAESNQPSD
KTLRRWKMISDAESRAIDRGGWGRLNFEEFQAIYKTQEEQGNHLDYLGSWIEFCIP*
Coding >OphauB2|6314
ATGTGGCCACCTACAACCTCGTCCATGTCGTCAGACACGCTGCTGCGCCCACGCGTCGCCGCGGTAATGGTGGCG
GCTGCCGCTTGCCTCTCGTTTGGCTATTACTATGGATTCTCGCAGGGAAGCTGGGAAATGTTCACGAATAGTTTA
TTTGGAAGCGCCACCAGACTCCACCGCAGCAATGCCACGCGACGTCCTCGCCGTCTACGCCGTGATGCCGCCCTC
AGGGCCATGTCTGCATCCTCATCGTCCTCGTCTGATGAAGGTGAAGACATTGAGAACCAACCAAACATAAGCTCC
CAAGACTTGGACAATCTCATGGACATTAACATGGGTGATTGGTGGCTAGATCCCCCAAACGAATATGCCTCTTCG
CAGCGAGCCGGCCATAACATTGTGAACCTTCTTTTCCGCGTCTCCGAGGACAATGCAAAGCGCAACGGCTATATT
CACCGCGGCTGCCAGTGCAACGCTTGCGGTGCCGTGCCCATTCGTGGCGTGCGCTACCGCTGCTCCAACTGCTCC
GACTTTGATTTGTGCGAGACGTGCGAGGCTCATGCCATGCATCACAAGACGCATATTTTTTACAAGATTCGAGTC
CCCGCTCCTCCATTTGGCCCTCGCCAGATTCAACCAGTTTGGTACACGGGGGATCCCAGTCCCTCAGCCAGCAAT
TTGTCTCGCCAGTTGATTACAAGATTTTCAGCAATTACTAGCTTTGAGCGGCCCGAACTCGAAGCATTTTGGGAA
CAGTGGACCTTTATGGCCAATACGGAATGGAGGGAAGACCCAGATGAGCTGTACCTTGCCATGGACCGCAAGACG
TTTGAGCGCTGTCTAGTGCCTACTGGAGGCTCCCGCCATACTCCCCCCAACCTTATTCACGATCGCATGTTTGCC
TTTTATGACACCAACAATGACGGCCTCATTGGCTTTGGCGAGTTCCTCCAGGGTCTGACGTATAGAAAGCGCCAA
GACAAGCTCAACAAGATTTTTGAGGGCTACGACATTGACTCGGACGGCTTGGTCAGCAGACTAGACTTTTTGCGC
ATGTTCCGCGCCTATTATGTGCTTTATAAGCAAATGCACAAGGATATTCTCGATGGTCTCCAAGATCAAATCATT
GCCAGCGTCGAAGCTCAACATTTGGTTGCGTCTCGTCAACCCATCAGCGCTCTCTTTGGCAGAGATAGCAGCTTG
CCTCGTGCTGACAGACCCAGGCCTCTTGTCGGCAAGACTATGCACCTTGACGGTTCTATTGAAGTTGAGGAGAGC
TTTCGACAGCCCACGGTGGCTGACAAGCCTGATACGGCCAGCAGAAACGAGATTTTGACTAGCCTTTTTGCCTAT
GGCGTTCAAAACCTGTCCCATCGACGTCTTATTCTTGGCAGAGACTTTGACTCCAACTGGCGCTCCATCAATCGC
TTGGCTGGCCTTGATGACGAAAGAAACCGAGCATACATCATGTCTGTACTCGATCCTCCTTCAAACCTGGACCAG
CTGGCAAGTACTTTGTCGGGCAACAATGACGGTAATCGGCATAATACCCCAGAAGGCGACGAGGTGGATGACGAA
TCTGACGAACAAGGAGGTGTGAGTCTTAGTCAGACATCTGCTAGCGCTGTCGACCGTCGAAACTCGTCGACGACG
AGTGCTCGTCTAGGCAGAAGGCCTCCCGATGGCCAGGGTCGTACATATGACCCAGAGAGGGCTAGAAGAGAATTG
GCACGCCACCGCTTGCATCAGAGATGGAGCAGACGCGATTTCTACCTTGATGTTGAAGAAGGGGGTGAGCCGCCA
GAAGATTGGAACAATGACGAAGACATCTTGGCGCAGGTTATGCAGGCTGCGCAAGATGTGGCAACGGCCGCTCAG
CCTTGTTCCACCGAGACCCAAACAGCCCCACAGTCTCGGCCACAAACAGAAGGAGTACATTATAACAATGTGACT
GCGCCTAGTGCGATTTCGCCGCTGGATAATGGGCCCGAGCAATCCACAGCTTTTGAGATTCCAGATGCCGAACGA
GATGCTGGCAAGGAAATTCTTTATCAAGTGACGCAGCAAGCGTTTAATGAGCTTCTTGACATTATTTTTCAAGAA
GCTGAAGAATTGGCCTTTGAAGCTGCCGAAACTAAAGACATTCGAGAGAGGTACAGAGCCCAAATTGAAGCTCTT
GATTCTAGTGGGACTCAAGAGGGCAATGTGGAAGCTCCAGCCTCTAGTGGGGTCTTTATGGATGAAGGCTTGGAG
CAGGAGAGAGGTGAAGCGGAAGCAGGCGAGCATCATCAGACGTTTGTCTCTCTTGATTCCGTTGATGTCGTTGAG
ACTAGCAGTCAACAAGACAGGTTTGGATTTCAAGACGGTGAAGAGTACAGAGACCCTACCATGCCTCAATTTCGA
CCCAACATTACACCGGAGCCAGCGCCAATGAATGAGGCGCAACATCACGAAGCAGAATCCAATCAGCCGAGCGAT
AAGACACTGCGGCGATGGAAGATGATTAGTGACGCTGAATCGCGAGCCATTGACCGAGGTGGCTGGGGCCGGCTC
AACTTTGAAGAATTTCAAGCCATTTACAAGACTCAAGAAGAACAGGGGAACCATTTGGACTATCTGGGTAGCTGG
ATCGAATTCTGCATTCCATAG
Transcript >OphauB2|6314
ATGTGGCCACCTACAACCTCGTCCATGTCGTCAGACACGCTGCTGCGCCCACGCGTCGCCGCGGTAATGGTGGCG
GCTGCCGCTTGCCTCTCGTTTGGCTATTACTATGGATTCTCGCAGGGAAGCTGGGAAATGTTCACGAATAGTTTA
TTTGGAAGCGCCACCAGACTCCACCGCAGCAATGCCACGCGACGTCCTCGCCGTCTACGCCGTGATGCCGCCCTC
AGGGCCATGTCTGCATCCTCATCGTCCTCGTCTGATGAAGGTGAAGACATTGAGAACCAACCAAACATAAGCTCC
CAAGACTTGGACAATCTCATGGACATTAACATGGGTGATTGGTGGCTAGATCCCCCAAACGAATATGCCTCTTCG
CAGCGAGCCGGCCATAACATTGTGAACCTTCTTTTCCGCGTCTCCGAGGACAATGCAAAGCGCAACGGCTATATT
CACCGCGGCTGCCAGTGCAACGCTTGCGGTGCCGTGCCCATTCGTGGCGTGCGCTACCGCTGCTCCAACTGCTCC
GACTTTGATTTGTGCGAGACGTGCGAGGCTCATGCCATGCATCACAAGACGCATATTTTTTACAAGATTCGAGTC
CCCGCTCCTCCATTTGGCCCTCGCCAGATTCAACCAGTTTGGTACACGGGGGATCCCAGTCCCTCAGCCAGCAAT
TTGTCTCGCCAGTTGATTACAAGATTTTCAGCAATTACTAGCTTTGAGCGGCCCGAACTCGAAGCATTTTGGGAA
CAGTGGACCTTTATGGCCAATACGGAATGGAGGGAAGACCCAGATGAGCTGTACCTTGCCATGGACCGCAAGACG
TTTGAGCGCTGTCTAGTGCCTACTGGAGGCTCCCGCCATACTCCCCCCAACCTTATTCACGATCGCATGTTTGCC
TTTTATGACACCAACAATGACGGCCTCATTGGCTTTGGCGAGTTCCTCCAGGGTCTGACGTATAGAAAGCGCCAA
GACAAGCTCAACAAGATTTTTGAGGGCTACGACATTGACTCGGACGGCTTGGTCAGCAGACTAGACTTTTTGCGC
ATGTTCCGCGCCTATTATGTGCTTTATAAGCAAATGCACAAGGATATTCTCGATGGTCTCCAAGATCAAATCATT
GCCAGCGTCGAAGCTCAACATTTGGTTGCGTCTCGTCAACCCATCAGCGCTCTCTTTGGCAGAGATAGCAGCTTG
CCTCGTGCTGACAGACCCAGGCCTCTTGTCGGCAAGACTATGCACCTTGACGGTTCTATTGAAGTTGAGGAGAGC
TTTCGACAGCCCACGGTGGCTGACAAGCCTGATACGGCCAGCAGAAACGAGATTTTGACTAGCCTTTTTGCCTAT
GGCGTTCAAAACCTGTCCCATCGACGTCTTATTCTTGGCAGAGACTTTGACTCCAACTGGCGCTCCATCAATCGC
TTGGCTGGCCTTGATGACGAAAGAAACCGAGCATACATCATGTCTGTACTCGATCCTCCTTCAAACCTGGACCAG
CTGGCAAGTACTTTGTCGGGCAACAATGACGGTAATCGGCATAATACCCCAGAAGGCGACGAGGTGGATGACGAA
TCTGACGAACAAGGAGGTGTGAGTCTTAGTCAGACATCTGCTAGCGCTGTCGACCGTCGAAACTCGTCGACGACG
AGTGCTCGTCTAGGCAGAAGGCCTCCCGATGGCCAGGGTCGTACATATGACCCAGAGAGGGCTAGAAGAGAATTG
GCACGCCACCGCTTGCATCAGAGATGGAGCAGACGCGATTTCTACCTTGATGTTGAAGAAGGGGGTGAGCCGCCA
GAAGATTGGAACAATGACGAAGACATCTTGGCGCAGGTTATGCAGGCTGCGCAAGATGTGGCAACGGCCGCTCAG
CCTTGTTCCACCGAGACCCAAACAGCCCCACAGTCTCGGCCACAAACAGAAGGAGTACATTATAACAATGTGACT
GCGCCTAGTGCGATTTCGCCGCTGGATAATGGGCCCGAGCAATCCACAGCTTTTGAGATTCCAGATGCCGAACGA
GATGCTGGCAAGGAAATTCTTTATCAAGTGACGCAGCAAGCGTTTAATGAGCTTCTTGACATTATTTTTCAAGAA
GCTGAAGAATTGGCCTTTGAAGCTGCCGAAACTAAAGACATTCGAGAGAGGTACAGAGCCCAAATTGAAGCTCTT
GATTCTAGTGGGACTCAAGAGGGCAATGTGGAAGCTCCAGCCTCTAGTGGGGTCTTTATGGATGAAGGCTTGGAG
CAGGAGAGAGGTGAAGCGGAAGCAGGCGAGCATCATCAGACGTTTGTCTCTCTTGATTCCGTTGATGTCGTTGAG
ACTAGCAGTCAACAAGACAGGTTTGGATTTCAAGACGGTGAAGAGTACAGAGACCCTACCATGCCTCAATTTCGA
CCCAACATTACACCGGAGCCAGCGCCAATGAATGAGGCGCAACATCACGAAGCAGAATCCAATCAGCCGAGCGAT
AAGACACTGCGGCGATGGAAGATGATTAGTGACGCTGAATCGCGAGCCATTGACCGAGGTGGCTGGGGCCGGCTC
AACTTTGAAGAATTTCAAGCCATTTACAAGACTCAAGAAGAACAGGGGAACCATTTGGACTATCTGGGTAGCTGG
ATCGAATTCTGCATTCCATAG
Gene >OphauB2|6314
ATGTGGCCACCTACAACCTCGTCCATGTCGTCAGACACGCTGCTGCGCCCACGCGTCGCCGCGGTAATGGTGGCG
GCTGCCGCTTGCCTCTCGTTTGGCTATTACTATGGATTCTCGCAGGGAAGCTGGGAAATGTTCACGAATAGTTTA
TTTGGAAGCGCCACCAGACTCCACCGCAGCAATGCCACGCGACGTCCTCGCCGTCTACGCCGTGATGCCGCCCTC
AGGGCCATGTCTGCATCCTCATCGTCCTCGTCTGATGAAGGTGAAGACATTGAGAACCAACCAAACATAAGCTCC
CAAGACTTGGACAATCTCATGGACATTAACATGGGTGATTGGTGGCTAGATCCCCCAAACGAATATGCCTCTTCG
CAGCGAGCCGGCCATAACATTGTGAACCTTCTTTTCCGCGTCTCCGAGGACAATGCAAAGCGCAACGGCTATATT
CACCGCGGCTGCCAGTGCAACGCTTGCGGTGCCGTGCCCATTCGTGGCGTGCGCTACCGCTGCTCCAACTGCTCC
GACTTTGATTTGTGCGAGACGTGCGAGGCTCATGCCATGCATCACAAGACGCATATTTTTTACAAGATTCGAGTC
CCCGCTCCTCCATTTGGCCCTCGCCAGATTCAACCAGTTTGGTACACGGGGGATCCCAGTCCCTCAGCCAGCAAT
TTGTCTCGCCAGTTGATTACAAGATTTTCAGCAATTACTAGCTTTGAGCGGCCCGAACTCGAAGCATTTTGGGAA
CAGTGGACCTTTATGGCCAATACGGAATGGAGGGAAGACCCAGATGAGCTGTACCTTGCCATGGACCGCAAGACG
TTTGAGCGCTGTCTAGTGCCTACTGGAGGCTCCCGCCATACTCCCCCCAACCTTATTCACGATCGCATGTTTGCC
TTTTATGACACCAACAATGACGGCCTCATTGGCTTTGGCGAGTTCCTCCAGGGTCTGACGTATAGAAAGCGCCAA
GACAAGCTCAACAAGATTTTTGAGGGCTACGACATTGACTCGGACGGCTTGGTCAGCAGACTAGACTTTTTGCGC
ATGTTCCGCGCCTATTATGTGCTTTATAAGCAAATGCACAAGGATATTCTCGATGGTCTCCAAGATCAAATCATT
GCCAGCGTCGAAGCTCAACATTTGGTTGCGTCTCGTCAACCCATCAGCGCTCTCTTTGGCAGAGATAGCAGCTTG
CCTCGTGCTGACAGACCCAGGCCTCTTGTCGGCAAGACTATGCACCTTGACGGTTCTATTGAAGTTGAGGAGAGC
TTTCGACAGCCCACGGTGGCTGACAAGCCTGATACGGCCAGCAGAAACGAGATTTTGACTAGCCTTTTTGCCTAT
GGCGTTCAAAACCTGTCCCATCGACGTCTTATTCTTGGCAGAGACTTTGACTCCAACTGGCGCTCCATCAATCGC
TTGGCTGGCCTTGATGACGAAAGAAACCGAGCATACATCATGTCTGTACTCGATCCTCCTTCAAACCTGGACCAG
CTGGCAAGTACTTTGTCGGGCAACAATGACGGTAATCGGCATAATACCCCAGAAGGCGACGAGGTGGATGACGAA
TCTGACGAACAAGGAGGTGTGAGTCTTAGTCAGACATCTGCTAGCGCTGTCGACCGTCGAAACTCGTCGACGACG
AGTGCTCGTCTAGGCAGAAGGCCTCCCGATGGCCAGGGTCGTACATATGACCCAGAGAGGGCTAGAAGAGAATTG
GCACGCCACCGCTTGCATCAGAGATGGAGCAGACGCGATTTCTACCTTGATGTTGAAGAAGGGGGTGAGCCGCCA
GAAGATTGGAACAATGACGAAGACATCTTGGCGCAGGTTATGCAGGCTGCGCAAGATGTGGCAACGGCCGCTCAG
CCTTGTTCCACCGAGACCCAAACAGCCCCACAGTCTCGGCCACAAACAGAAGGAGTACATTATAACAATGTGACT
GCGCCTAGTGCGATTTCGCCGCTGGATAATGGGCCCGAGCAATCCACAGCTTTTGAGATTCCAGATGCCGAACGA
GATGCTGGCAAGGAAATTCTTTATCAAGTGACGCAGCAAGCGTTTAATGAGCTTCTTGACATTATTTTTCAAGAA
GCTGAAGAATTGGCCTTTGAAGCTGCCGAAACTAAAGACATTCGAGAGAGGTACAGAGCCCAAATTGAAGCTCTT
GATTCTAGTGGGACTCAAGAGGGCAATGTGGAAGCTCCAGCCTCTAGTGGGGTCTTTATGGATGAAGGCTTGGAG
CAGGAGAGAGGTGAAGCGGAAGCAGGCGAGCATCATCAGACGTTTGTCTCTCTTGATTCCGTTGATGTCGTTGAG
ACTAGCAGTCAACAAGACAGGTTTGGATTTCAAGACGGTGAAGAGTACAGAGACCCTACCATGCCTCAATTTCGA
CCCAACATTACACCGGAGCCAGCGCCAATGAATGAGGCGCAACATCACGAAGCAGAATCCAATCAGCCGAGCGAT
AAGACACTGCGGCGATGGAAGATGATTAGTGACGCTGAATCGCGAGCCATTGACCGAGGTGGCTGGGGCCGGCTC
AACTTTGAAGAATTTCAAGCCATTTACAAGACTCAAGAAGAACAGGGGAACCATTTGGACTATCTGGGTAGCTGG
ATCGAATTCTGCATTCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail