Protein ID | OphauB2|6313 |
Gene name | |
Location | Contig_57:34478..35394 |
Strand | - |
Gene length (bp) | 916 |
Transcript length (bp) | 720 |
Coding sequence length (bp) | 720 |
Protein length (aa) | 240 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF04588 | HIG_1_N | Hypoxia induced protein conserved region | 3.3E-21 | 43 | 94 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|C7YJ02|RCF1_NECH7 | Respiratory supercomplex factor 1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RCF1 PE=3 SV=1 | 11 | 227 | 7.0E-74 |
sp|C9SF29|RCF1_VERA1 | Respiratory supercomplex factor 1, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=RCF1 PE=3 SV=1 | 18 | 194 | 4.0E-63 |
sp|Q875C2|RCF1_PODAN | Respiratory supercomplex factor 1, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=RCF1 PE=3 SV=1 | 17 | 171 | 2.0E-58 |
sp|Q7S455|RCF1_NEUCR | Respiratory supercomplex factor 1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rcf1 PE=3 SV=2 | 12 | 155 | 3.0E-55 |
sp|Q2GMG9|RCF1_CHAGB | Respiratory supercomplex factor 1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RCF1 PE=3 SV=1 | 27 | 146 | 3.0E-51 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|C7YJ02|RCF1_NECH7 | Respiratory supercomplex factor 1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RCF1 PE=3 SV=1 | 11 | 227 | 7.0E-74 |
sp|C9SF29|RCF1_VERA1 | Respiratory supercomplex factor 1, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=RCF1 PE=3 SV=1 | 18 | 194 | 4.0E-63 |
sp|Q875C2|RCF1_PODAN | Respiratory supercomplex factor 1, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=RCF1 PE=3 SV=1 | 17 | 171 | 2.0E-58 |
sp|Q7S455|RCF1_NEUCR | Respiratory supercomplex factor 1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rcf1 PE=3 SV=2 | 12 | 155 | 3.0E-55 |
sp|Q2GMG9|RCF1_CHAGB | Respiratory supercomplex factor 1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RCF1 PE=3 SV=1 | 27 | 146 | 3.0E-51 |
sp|A4RI25|RCF1_MAGO7 | Respiratory supercomplex factor 1, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RCF1 PE=3 SV=1 | 20 | 144 | 5.0E-46 |
sp|B2WBP3|RCF1_PYRTR | Respiratory supercomplex factor 1, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rcf1 PE=3 SV=1 | 13 | 151 | 2.0E-41 |
sp|Q0V4P1|RCF1_PHANO | Respiratory supercomplex factor 1, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RCF1 PE=3 SV=1 | 12 | 151 | 3.0E-41 |
sp|A6SSX6|RCF1_BOTFB | Respiratory supercomplex factor 1, mitochondrial OS=Botryotinia fuckeliana (strain B05.10) GN=rcf1 PE=3 SV=1 | 16 | 165 | 1.0E-40 |
sp|C5FSQ7|RCF1_ARTOC | Respiratory supercomplex factor 1, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=RCF1 PE=3 SV=1 | 17 | 141 | 4.0E-40 |
sp|Q2UGQ3|RCF1_ASPOR | Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rcf1 PE=3 SV=1 | 17 | 141 | 2.0E-37 |
sp|B8N9M0|RCF1_ASPFN | Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rcf1 PE=3 SV=1 | 17 | 141 | 2.0E-37 |
sp|B6H465|RCF1_PENRW | Respiratory supercomplex factor 1, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rcf1 PE=3 SV=1 | 17 | 141 | 2.0E-36 |
sp|Q0CLP4|RCF1_ASPTN | Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rcf1 PE=3 SV=1 | 17 | 141 | 3.0E-36 |
sp|Q4WP59|RCF1_ASPFU | Respiratory supercomplex factor 1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rcf1 PE=3 SV=1 | 17 | 141 | 1.0E-35 |
sp|B0Y606|RCF1_ASPFC | Respiratory supercomplex factor 1, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rcf1 PE=3 SV=1 | 17 | 141 | 1.0E-35 |
sp|A2QI79|RCF1_ASPNC | Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rcf1 PE=3 SV=1 | 17 | 141 | 3.0E-35 |
sp|A1CXG2|RCF1_NEOFI | Respiratory supercomplex factor 1, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rcf1 PE=3 SV=1 | 17 | 141 | 4.0E-35 |
sp|A7F679|RCF1_SCLS1 | Respiratory supercomplex factor 1, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rcf1 PE=3 SV=1 | 13 | 136 | 4.0E-35 |
sp|A1CHC5|RCF1_ASPCL | Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rcf1 PE=3 SV=1 | 14 | 141 | 5.0E-35 |
sp|C5P447|RCF1_COCP7 | Respiratory supercomplex factor 1, mitochondrial OS=Coccidioides posadasii (strain C735) GN=RCF1 PE=3 SV=1 | 17 | 161 | 6.0E-35 |
sp|Q5B6J9|RCF1_EMENI | Respiratory supercomplex factor 1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rcf1 PE=3 SV=1 | 17 | 141 | 2.0E-33 |
sp|C5JIT3|RCF1_AJEDS | Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=RCF1 PE=3 SV=1 | 11 | 141 | 6.0E-33 |
sp|C5GDJ2|RCF1_AJEDR | Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=RCF1 PE=3 SV=1 | 11 | 141 | 6.0E-33 |
sp|A6RBB3|RCF1_AJECN | Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RCF1 PE=3 SV=1 | 16 | 141 | 1.0E-32 |
sp|C6H220|RCF1_AJECH | Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=RCF1 PE=3 SV=1 | 16 | 141 | 1.0E-32 |
sp|C0NUL6|RCF1_AJECG | Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=RCF1 PE=3 SV=1 | 16 | 141 | 1.0E-32 |
sp|C0RYW2|RCF1_PARBP | Respiratory supercomplex factor 1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=RCF1 PE=3 SV=1 | 16 | 141 | 3.0E-31 |
sp|C1G794|RCF1_PARBD | Respiratory supercomplex factor 1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=RCF1 PE=3 SV=1 | 16 | 141 | 3.0E-31 |
sp|B6QHL9|RCF1A_TALMQ | Respiratory supercomplex factor 1-A, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rcf1-A PE=3 SV=1 | 27 | 141 | 2.0E-30 |
sp|B6QHL8|RCF1B_TALMQ | Respiratory supercomplex factor 1-B, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rcf1-B PE=3 SV=1 | 27 | 141 | 2.0E-30 |
sp|B8MJJ2|RCF1_TALSN | Respiratory supercomplex factor 1, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=rcf1 PE=3 SV=1 | 28 | 141 | 7.0E-30 |
sp|D4DDK2|RCF1_TRIVH | Respiratory supercomplex factor 1, mitochondrial OS=Trichophyton verrucosum (strain HKI 0517) GN=RCF1 PE=3 SV=1 | 35 | 160 | 7.0E-30 |
sp|Q6CBQ8|RCF1_YARLI | Respiratory supercomplex factor 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RCF1 PE=3 SV=2 | 15 | 141 | 3.0E-23 |
sp|C4JHR1|RCF1_UNCRE | Respiratory supercomplex factor 1, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=RCF1 PE=3 SV=1 | 17 | 155 | 1.0E-22 |
sp|C4QV79|RCF1_PICPG | Respiratory supercomplex factor 1, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=RCF1 PE=3 SV=1 | 19 | 156 | 1.0E-19 |
sp|Q6CWT4|RCF1_KLULA | Respiratory supercomplex factor 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RCF1 PE=3 SV=1 | 15 | 148 | 1.0E-19 |
sp|C5DLZ7|RCF1_LACTC | Respiratory supercomplex factor 1, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RCF1 PE=3 SV=1 | 15 | 148 | 5.0E-18 |
sp|C4Y631|RCF1_CLAL4 | Respiratory supercomplex factor 1, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=RCF1 PE=3 SV=1 | 33 | 143 | 1.0E-17 |
sp|Q6BIT1|RCF1_DEBHA | Respiratory supercomplex factor 1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RCF1 PE=3 SV=2 | 18 | 148 | 2.0E-17 |
sp|A7TFU8|RCF1_VANPO | Respiratory supercomplex factor 1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RCF1 PE=3 SV=1 | 15 | 155 | 3.0E-17 |
sp|B9WHT6|RCF1_CANDC | Respiratory supercomplex factor 1, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RCF1 PE=3 SV=1 | 18 | 143 | 7.0E-17 |
sp|A5DHC2|RCF1_PICGU | Respiratory supercomplex factor 1, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RCF1 PE=3 SV=1 | 34 | 132 | 3.0E-16 |
sp|C4YRP9|RCF1_CANAW | Respiratory supercomplex factor 1, mitochondrial OS=Candida albicans (strain WO-1) GN=RCF1 PE=3 SV=1 | 18 | 143 | 4.0E-16 |
sp|C5DWC4|RCF1_ZYGRC | Respiratory supercomplex factor 1, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RCF1 PE=3 SV=1 | 15 | 146 | 8.0E-16 |
sp|A5E2M7|RCF1_LODEL | Respiratory supercomplex factor 1, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RCF1 PE=3 SV=1 | 18 | 143 | 2.0E-15 |
sp|B6K2Z6|RCF1_SCHJY | Respiratory supercomplex factor 1, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rcf1 PE=3 SV=1 | 8 | 111 | 1.0E-14 |
sp|Q6FSW5|RCF1_CANGA | Respiratory supercomplex factor 1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RCF1 PE=3 SV=1 | 15 | 134 | 2.0E-14 |
sp|C5MAV2|RCF1_CANTT | Respiratory supercomplex factor 1, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RCF1 PE=3 SV=1 | 15 | 143 | 4.0E-14 |
sp|Q59N74|RCF1_CANAL | Respiratory supercomplex factor 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RCF1 PE=3 SV=1 | 37 | 143 | 1.0E-13 |
sp|Q756G1|RCF1_ASHGO | Respiratory supercomplex factor 1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RCF1 PE=3 SV=1 | 15 | 150 | 1.0E-13 |
sp|A8P006|RCF1_COPC7 | Respiratory supercomplex factor 1, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=RCF1 PE=3 SV=1 | 35 | 161 | 8.0E-12 |
sp|Q03713|RCF1_YEAST | Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCF1 PE=1 SV=1 | 15 | 98 | 9.0E-12 |
sp|C8ZEH4|RCF1_YEAS8 | Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RCF1 PE=3 SV=1 | 15 | 98 | 9.0E-12 |
sp|A6ZM32|RCF1_YEAS7 | Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=RCF1 PE=3 SV=1 | 15 | 98 | 9.0E-12 |
sp|C7GT60|RCF1_YEAS2 | Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=RCF1 PE=3 SV=1 | 15 | 98 | 9.0E-12 |
sp|B3LLM2|RCF1_YEAS1 | Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RCF1 PE=3 SV=1 | 15 | 98 | 9.0E-12 |
sp|A3LVL1|RCF1_PICST | Respiratory supercomplex factor 1, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RCF1 PE=3 SV=1 | 37 | 132 | 1.0E-11 |
sp|Q4PIK6|RCF1_USTMA | Respiratory supercomplex factor 1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RCF1 PE=3 SV=1 | 31 | 105 | 1.0E-11 |
sp|Q9CQJ1|HIG2A_MOUSE | HIG1 domain family member 2A OS=Mus musculus GN=Higd2a PE=3 SV=1 | 35 | 94 | 4.0E-10 |
sp|B0D4J7|RCF1_LACBS | Respiratory supercomplex factor 1, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=RCF1 PE=3 SV=1 | 35 | 107 | 6.0E-10 |
sp|Q9BW72|HIG2A_HUMAN | HIG1 domain family member 2A, mitochondrial OS=Homo sapiens GN=HIGD2A PE=1 SV=1 | 35 | 94 | 3.0E-08 |
sp|Q4VC39|HIG2B_HUMAN | Putative HIG1 domain family member 2B OS=Homo sapiens GN=HIGD2B PE=5 SV=1 | 35 | 94 | 2.0E-07 |
sp|Q9P298|HIG1B_HUMAN | HIG1 domain family member 1B OS=Homo sapiens GN=HIGD1B PE=1 SV=1 | 35 | 97 | 2.0E-06 |
sp|Q99JY6|HIG1B_MOUSE | HIG1 domain family member 1B OS=Mus musculus GN=Higd1b PE=1 SV=1 | 35 | 97 | 2.0E-06 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 11 | 0.5 |
Domain # | Start | End | Length |
---|---|---|---|
1 | 46 | 65 | 19 |
2 | 77 | 99 | 22 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauB2|6313 MASRLPPPPPPPPDLAPMPSSFDGNDDFYNERPLQKMLRKLKEEPLIPLGAGLTVAAFINSWRAVRRGDSHQANR MFRARVAAQAFTIIAMVAGSMYYSRDREKTKELRRLKDLRDAEEKRLRWIRELEARDEEEKAFRARMDRRRAQGA AADDAPSEGGILGKMGLWKNGEQTSSTGQDEHVEAAAAVADKPVENDGEREQKPSRRHNPKSSLDAISGVILSQK KDGKHSSKDDKSEK* |
Coding | >OphauB2|6313 ATGGCCAGCCGCTTGCCACCGCCGCCGCCGCCGCCTCCCGACCTGGCGCCCATGCCATCGTCGTTTGACGGAAAC GACGACTTTTACAATGAGCGCCCGTTGCAGAAAATGCTGCGCAAGCTCAAGGAAGAGCCCTTGATACCGCTCGGC GCCGGCCTCACCGTTGCCGCCTTTATCAACTCGTGGCGCGCCGTCCGCCGCGGCGACTCTCACCAAGCAAACCGC ATGTTTCGCGCCCGCGTCGCCGCCCAAGCCTTTACCATCATCGCCATGGTGGCTGGAAGCATGTACTATAGCCGC GATCGCGAAAAGACAAAGGAGCTGCGCCGCCTCAAGGACCTGCGCGATGCTGAAGAGAAGCGCCTTCGCTGGATC CGCGAGCTCGAGGCCCGCGATGAGGAGGAAAAGGCCTTTCGCGCTCGAATGGACCGCCGACGCGCTCAGGGTGCA GCGGCTGATGATGCTCCCTCTGAGGGCGGCATTCTTGGAAAAATGGGCTTGTGGAAGAATGGCGAGCAAACTTCT AGCACTGGCCAAGATGAACATGTTGAAGCAGCGGCAGCCGTTGCTGACAAGCCTGTAGAAAATGACGGGGAGCGG GAGCAGAAGCCATCAAGAAGGCACAACCCCAAGAGCTCACTCGACGCCATTAGCGGAGTCATTCTCTCCCAAAAG AAGGATGGCAAGCATTCCTCTAAAGACGACAAATCCGAAAAGTAG |
Transcript | >OphauB2|6313 ATGGCCAGCCGCTTGCCACCGCCGCCGCCGCCGCCTCCCGACCTGGCGCCCATGCCATCGTCGTTTGACGGAAAC GACGACTTTTACAATGAGCGCCCGTTGCAGAAAATGCTGCGCAAGCTCAAGGAAGAGCCCTTGATACCGCTCGGC GCCGGCCTCACCGTTGCCGCCTTTATCAACTCGTGGCGCGCCGTCCGCCGCGGCGACTCTCACCAAGCAAACCGC ATGTTTCGCGCCCGCGTCGCCGCCCAAGCCTTTACCATCATCGCCATGGTGGCTGGAAGCATGTACTATAGCCGC GATCGCGAAAAGACAAAGGAGCTGCGCCGCCTCAAGGACCTGCGCGATGCTGAAGAGAAGCGCCTTCGCTGGATC CGCGAGCTCGAGGCCCGCGATGAGGAGGAAAAGGCCTTTCGCGCTCGAATGGACCGCCGACGCGCTCAGGGTGCA GCGGCTGATGATGCTCCCTCTGAGGGCGGCATTCTTGGAAAAATGGGCTTGTGGAAGAATGGCGAGCAAACTTCT AGCACTGGCCAAGATGAACATGTTGAAGCAGCGGCAGCCGTTGCTGACAAGCCTGTAGAAAATGACGGGGAGCGG GAGCAGAAGCCATCAAGAAGGCACAACCCCAAGAGCTCACTCGACGCCATTAGCGGAGTCATTCTCTCCCAAAAG AAGGATGGCAAGCATTCCTCTAAAGACGACAAATCCGAAAAGTAG |
Gene | >OphauB2|6313 ATGGCCAGCCGCTTGCCACCGCCGCCGCCGCCGCCTCCCGACCTGGCGCCCATGCCATCGTCGTTTGACGGAAAC GAGTTGGTCTTGTTCAACGCCACGACGACGCTCCGTTGCAGCTAACACCAAGCAGCGACTTTTACAATGAGCGCC CGTTGCAGAAAATGCTGCGCAAGCTCAAGGAAGAGCCCTTGATACCGCTCGGTCTGTAGCCGTGCGAATAAATGA TGCGAGCTTGACGACTTGTTCTTGATGCTGTCCTGTCCAATGCCAATGGGCTCTCTACAGTCGCTCCCTTTGTGT CTCAACCCGGTCAAGCTCTCCCTCTAACCAGAATCATGGTCCAGGCGCCGGCCTCACCGTTGCCGCCTTTATCAA CTCGTGGCGCGCCGTCCGCCGCGGCGACTCTCACCAAGCAAACCGCATGTTTCGCGCCCGCGTCGCCGCCCAAGC CTTTACCATCATCGCCATGGTGGCTGGAAGCATGTACTATAGCCGCGATCGCGAAAAGACAAAGGAGCTGCGCCG CCTCAAGGACCTGCGCGATGCTGAAGAGAAGCGCCTTCGCTGGATCCGCGAGCTCGAGGCCCGCGATGAGGAGGA AAAGGCCTTTCGCGCTCGAATGGACCGCCGACGCGCTCAGGGTGCAGCGGCTGATGATGCTCCCTCTGAGGGCGG CATTCTTGGAAAAATGGGCTTGTGGAAGAATGGCGAGCAAACTTCTAGCACTGGCCAAGATGAACATGTTGAAGC AGCGGCAGCCGTTGCTGACAAGCCTGTAGAAAATGACGGGGAGCGGGAGCAGAAGCCATCAAGAAGGCACAACCC CAAGAGCTCACTCGACGCCATTAGCGGAGTCATTCTCTCCCAAAAGAAGGATGGCAAGCATTCCTCTAAAGACGA CAAATCCGAAAAGTAG |