Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6307
Gene name
LocationContig_57:20987..21972
Strand+
Gene length (bp)985
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09749 HVSL Uncharacterised conserved protein 7.6E-82 43 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEZ0|USB1_NEUCR U6 snRNA phosphodiesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=usb1 PE=3 SV=2 31 293 9.0E-52
sp|Q91W78|USB1_MOUSE U6 snRNA phosphodiesterase OS=Mus musculus GN=Usb1 PE=2 SV=1 3 293 4.0E-10
sp|Q5I0I5|USB1_RAT U6 snRNA phosphodiesterase OS=Rattus norvegicus GN=Usb1 PE=2 SV=1 3 293 5.0E-10
sp|Q9VHB3|USB1_DROME U6 snRNA phosphodiesterase OS=Drosophila melanogaster GN=CG16790 PE=2 SV=1 59 253 6.0E-09
sp|Q0II50|USB1_BOVIN U6 snRNA phosphodiesterase OS=Bos taurus GN=USB1 PE=2 SV=1 3 293 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEZ0|USB1_NEUCR U6 snRNA phosphodiesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=usb1 PE=3 SV=2 31 293 9.0E-52
sp|Q91W78|USB1_MOUSE U6 snRNA phosphodiesterase OS=Mus musculus GN=Usb1 PE=2 SV=1 3 293 4.0E-10
sp|Q5I0I5|USB1_RAT U6 snRNA phosphodiesterase OS=Rattus norvegicus GN=Usb1 PE=2 SV=1 3 293 5.0E-10
sp|Q9VHB3|USB1_DROME U6 snRNA phosphodiesterase OS=Drosophila melanogaster GN=CG16790 PE=2 SV=1 59 253 6.0E-09
sp|Q0II50|USB1_BOVIN U6 snRNA phosphodiesterase OS=Bos taurus GN=USB1 PE=2 SV=1 3 293 1.0E-08
sp|Q7ZYI9|USB1_XENLA U6 snRNA phosphodiesterase OS=Xenopus laevis GN=usb1 PE=2 SV=1 1 294 1.0E-07
sp|Q6DEF6|USB1_DANRE U6 snRNA phosphodiesterase OS=Danio rerio GN=usb1 PE=2 SV=1 44 293 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0034477 U6 snRNA 3'-end processing Yes
GO:0004518 nuclease activity Yes
GO:0090304 nucleic acid metabolic process No
GO:0016073 snRNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0034472 snRNA 3'-end processing No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0016180 snRNA processing No
GO:0034470 ncRNA processing No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0031123 RNA 3'-end processing No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6307
MALVDYSSSAESDNHHDEAPKRKRRRRVGTPSPACGEYESAMPPLPAAFHDLYASTVRHSVVDDPSLHQGRKRQI
PHIRGNWPSHIYIEWHPTTKQHHVLCQLVDAVAAQLADGFKLHSLLTSDLSAPLPLHISLSRPMSLPGAEKEAFL
AHLGQLLQGSAVPRRGQATSTTAAFTVRLTGLAWFPSPDSNRTFLVLRIASSDDADANPELAALLTRCNTVAARF
KQPPLYAKMERQDMCFHISVGWTLGRLEQGSDLATLTDKPPFCDALDWRIEVAGVKAKMGNVVSHIPLLGSRRAS
GPIDQSLM*
Coding >OphauB2|6307
ATGGCCCTGGTCGATTATTCCTCATCCGCCGAGTCAGATAACCACCATGACGAGGCACCAAAGCGAAAGCGCCGC
CGACGTGTCGGCACTCCATCTCCAGCTTGTGGCGAATACGAATCGGCCATGCCCCCACTCCCTGCCGCTTTCCAC
GATCTCTACGCCTCAACCGTTCGCCACAGTGTCGTCGACGACCCCAGCCTCCACCAGGGCCGTAAACGTCAGATT
CCACATATCCGGGGCAACTGGCCTTCGCACATCTACATTGAATGGCACCCGACTACGAAGCAGCATCATGTGCTT
TGCCAGCTTGTCGACGCTGTTGCCGCCCAGCTTGCAGATGGCTTCAAATTACACAGCCTCTTGACGAGCGATTTG
AGCGCACCGCTGCCGCTCCACATTAGTCTCTCGCGCCCCATGAGCCTCCCTGGCGCTGAAAAGGAGGCCTTTCTT
GCCCACCTTGGGCAGCTTTTGCAAGGCTCGGCTGTGCCTCGTCGTGGCCAAGCGACTAGCACCACGGCTGCCTTT
ACTGTGCGTCTGACGGGGCTGGCCTGGTTTCCCTCGCCCGACTCGAATCGGACTTTTCTCGTGCTGCGAATTGCA
AGCTCCGACGACGCCGACGCTAACCCAGAGCTCGCAGCGTTGCTTACGCGGTGCAACACTGTTGCTGCGCGCTTC
AAGCAACCGCCACTGTACGCAAAGATGGAGCGCCAAGACATGTGCTTCCACATCTCTGTTGGCTGGACACTGGGA
CGACTGGAGCAAGGCTCAGACCTTGCCACGCTGACGGACAAGCCGCCCTTTTGCGACGCACTAGACTGGAGAATT
GAAGTGGCTGGTGTCAAGGCCAAGATGGGCAATGTGGTGAGCCACATTCCACTGTTGGGCTCTCGCCGCGCGAGC
GGGCCTATTGACCAGTCTTTGATGTGA
Transcript >OphauB2|6307
ATGGCCCTGGTCGATTATTCCTCATCCGCCGAGTCAGATAACCACCATGACGAGGCACCAAAGCGAAAGCGCCGC
CGACGTGTCGGCACTCCATCTCCAGCTTGTGGCGAATACGAATCGGCCATGCCCCCACTCCCTGCCGCTTTCCAC
GATCTCTACGCCTCAACCGTTCGCCACAGTGTCGTCGACGACCCCAGCCTCCACCAGGGCCGTAAACGTCAGATT
CCACATATCCGGGGCAACTGGCCTTCGCACATCTACATTGAATGGCACCCGACTACGAAGCAGCATCATGTGCTT
TGCCAGCTTGTCGACGCTGTTGCCGCCCAGCTTGCAGATGGCTTCAAATTACACAGCCTCTTGACGAGCGATTTG
AGCGCACCGCTGCCGCTCCACATTAGTCTCTCGCGCCCCATGAGCCTCCCTGGCGCTGAAAAGGAGGCCTTTCTT
GCCCACCTTGGGCAGCTTTTGCAAGGCTCGGCTGTGCCTCGTCGTGGCCAAGCGACTAGCACCACGGCTGCCTTT
ACTGTGCGTCTGACGGGGCTGGCCTGGTTTCCCTCGCCCGACTCGAATCGGACTTTTCTCGTGCTGCGAATTGCA
AGCTCCGACGACGCCGACGCTAACCCAGAGCTCGCAGCGTTGCTTACGCGGTGCAACACTGTTGCTGCGCGCTTC
AAGCAACCGCCACTGTACGCAAAGATGGAGCGCCAAGACATGTGCTTCCACATCTCTGTTGGCTGGACACTGGGA
CGACTGGAGCAAGGCTCAGACCTTGCCACGCTGACGGACAAGCCGCCCTTTTGCGACGCACTAGACTGGAGAATT
GAAGTGGCTGGTGTCAAGGCCAAGATGGGCAATGTGGTGAGCCACATTCCACTGTTGGGCTCTCGCCGCGCGAGC
GGGCCTATTGACCAGTCTTTGATGTGA
Gene >OphauB2|6307
ATGGCCCTGGTCGATTATTCCTCATCCGCCGAGTCAGATAACCACCATGACGAGGCACCAAAGCGAAAGCGCCGC
CGACGTGTCGGCACTCCATCTCCAGCTTGTGGCGAATACGAATCGGCCATGCCCCCACTCCCTGCCGCTTTCCAC
GATCTCTACGCCTCAACCGTTCGCCACAGTGTCGTCGACGACCCCAGCCTCCACCAGGGCCGTAAACGTCAGATT
CCACATATCCGGGGCAACTGGCCTTCGCACATCTACATTGAATGTTGGGAAGCCTCGCATTATGGGCCGACGGCG
CCACTGAGCTGACGCGTCGAGGATAGGGCACCCGACTACGAAGCAGCATCATGTGCTTTGCCAGCTTGTCGACGC
TGTTGCCGCCCAGCTTGCAGATGGCTTCAAATTACACAGCCTCTTGACGAGCGATTTGAGCGCACCGCTGCCGCT
CCACATTAGTCTCTCGCGCCCCATGAGCCTCCCTGGCGCTGAAAAGGAGGCCTTTCTTGCCCACCTTGGGCAGCT
TTTGCAAGGCTCGGCTGTGCCTCGTCGTGGCCAAGCGACTAGCACCACGGCTGCCTTTACTGTGCGTCTGACGGG
GCTGGCCTGGTTTCCCTCGCCCGACTCGAATCGGACTTTTCTCGTGCTGCGAATTGCAAGCTCCGACGACGCCGA
CGCTAACCCAGAGCTCGCAGCGTTGCTTACGCGGTGCAACACTGTTGCTGCGCGCTTCAAGCAACCGCCACTGTA
CGCAAAGATGGAGCGCCAAGACATGTGCTTCCACATCTCTGTTGGCTGGACACTGGGACGACTGGAGCAAGGCTC
AGACCTTGCCACGCTGACGGACAAGCCGCCCTTTTGCGACGCACTAGACTGGAGAATTGAAGTGGCTGGTGTCAA
GGCCAAGATGGGCAATGTGGTGAGCCACATTCCACTGTTGGGCTCTCGCCGCGCGAGCGGGCCTATTGACCAGTC
TTTGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail