Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6305
Gene name
LocationContig_57:12226..16778
Strand+
Gene length (bp)4552
Transcript length (bp)4329
Coding sequence length (bp)4329
Protein length (aa) 1443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03178 CPSF_A CPSF A subunit region 4.6E-74 1055 1404
PF10433 MMS1_N Mono-functional DNA-alkylating methyl methanesulfonate N-term 8.6E-17 171 751

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0UUE2|CFT1_PHANO Protein CFT1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CFT1 PE=3 SV=1 1 1420 0.0E+00
sp|Q1E5B0|CFT1_COCIM Protein CFT1 OS=Coccidioides immitis (strain RS) GN=CFT1 PE=3 SV=1 1 1435 0.0E+00
sp|A1DB13|CFT1_NEOFI Protein cft1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cft1 PE=3 SV=1 1 1442 0.0E+00
sp|Q4WCL1|CFT1_ASPFU Protein cft1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cft1 PE=3 SV=2 1 1442 0.0E+00
sp|A1C3U1|CFT1_ASPCL Protein cft1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cft1 PE=3 SV=1 1 1442 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0UUE2|CFT1_PHANO Protein CFT1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CFT1 PE=3 SV=1 1 1420 0.0E+00
sp|Q1E5B0|CFT1_COCIM Protein CFT1 OS=Coccidioides immitis (strain RS) GN=CFT1 PE=3 SV=1 1 1435 0.0E+00
sp|A1DB13|CFT1_NEOFI Protein cft1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cft1 PE=3 SV=1 1 1442 0.0E+00
sp|Q4WCL1|CFT1_ASPFU Protein cft1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cft1 PE=3 SV=2 1 1442 0.0E+00
sp|A1C3U1|CFT1_ASPCL Protein cft1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cft1 PE=3 SV=1 1 1442 0.0E+00
sp|Q2TZ19|CFT1_ASPOR Protein cft1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cft1 PE=3 SV=1 1 1435 0.0E+00
sp|Q5BDG7|CFT1_EMENI Protein cft1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cft1 PE=3 SV=1 1 1435 0.0E+00
sp|A2R919|CFT1_ASPNC Protein cft1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cft1 PE=3 SV=1 1 1435 0.0E+00
sp|Q7SEY2|CFT1_NEUCR Protein cft1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-3 PE=3 SV=3 1 1420 0.0E+00
sp|Q6BHK3|CFT1_DEBHA Protein CFT1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CFT1 PE=3 SV=2 1 1430 2.0E-119
sp|Q6C740|CFT1_YARLI Protein CFT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CFT1 PE=3 SV=1 1 1419 4.0E-115
sp|Q10569|CPSF1_BOVIN Cleavage and polyadenylation specificity factor subunit 1 OS=Bos taurus GN=CPSF1 PE=1 SV=1 3 1419 5.0E-108
sp|Q6CTT2|CFT1_KLULA Protein CFT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CFT1 PE=3 SV=1 1 1430 1.0E-85
sp|Q6FSD2|CFT1_CANGA Protein CFT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CFT1 PE=3 SV=1 85 1430 1.0E-81
sp|Q75EY8|CFT1_ASHGO Protein CFT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CFT1 PE=3 SV=1 72 1430 1.0E-80
sp|O74733|CFT1_SCHPO Protein cft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cft1 PE=3 SV=1 787 1419 2.0E-75
sp|Q06632|CFT1_YEAST Protein CFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CFT1 PE=1 SV=1 85 1419 7.0E-75
sp|Q7XWP1|CPSF1_ORYSJ Probable cleavage and polyadenylation specificity factor subunit 1 OS=Oryza sativa subsp. japonica GN=Os04g0252200 PE=3 SV=2 28 1419 8.0E-73
sp|O74733|CFT1_SCHPO Protein cft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cft1 PE=3 SV=1 3 738 7.0E-67
sp|Q5AFT3|CFT1_CANAL Protein CFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFT1 PE=3 SV=1 837 1423 6.0E-63
sp|Q9EPU4|CPSF1_MOUSE Cleavage and polyadenylation specificity factor subunit 1 OS=Mus musculus GN=Cpsf1 PE=1 SV=1 789 1419 2.0E-55
sp|Q10570|CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens GN=CPSF1 PE=1 SV=2 789 1419 3.0E-54
sp|Q9V726|CPSF1_DROME Cleavage and polyadenylation specificity factor subunit 1 OS=Drosophila melanogaster GN=Cpsf160 PE=1 SV=1 794 1428 3.0E-48
sp|Q9EPU4|CPSF1_MOUSE Cleavage and polyadenylation specificity factor subunit 1 OS=Mus musculus GN=Cpsf1 PE=1 SV=1 3 771 3.0E-47
sp|Q10570|CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens GN=CPSF1 PE=1 SV=2 88 766 3.0E-46
sp|Q5AFT3|CFT1_CANAL Protein CFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFT1 PE=3 SV=1 1 454 1.0E-43
sp|P0CM62|CFT1_CRYNJ Protein CFT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CFT1 PE=3 SV=1 28 732 3.0E-42
sp|P0CM63|CFT1_CRYNB Protein CFT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CFT1 PE=3 SV=1 28 732 3.0E-42
sp|Q9V726|CPSF1_DROME Cleavage and polyadenylation specificity factor subunit 1 OS=Drosophila melanogaster GN=Cpsf160 PE=1 SV=1 98 732 4.0E-41
sp|P0CM62|CFT1_CRYNJ Protein CFT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CFT1 PE=3 SV=1 790 1436 1.0E-40
sp|P0CM63|CFT1_CRYNB Protein CFT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CFT1 PE=3 SV=1 790 1436 1.0E-40
sp|A8XPU7|CPSF1_CAEBR Probable cleavage and polyadenylation specificity factor subunit 1 OS=Caenorhabditis briggsae GN=cpsf-1 PE=3 SV=1 955 1428 2.0E-34
sp|Q9N4C2|CPSF1_CAEEL Probable cleavage and polyadenylation specificity factor subunit 1 OS=Caenorhabditis elegans GN=cpsf-1 PE=3 SV=2 955 1428 6.0E-34
sp|Q9FGR0|CPSF1_ARATH Cleavage and polyadenylation specificity factor subunit 1 OS=Arabidopsis thaliana GN=CPSF160 PE=1 SV=2 920 1419 2.0E-31
sp|Q9FGR0|CPSF1_ARATH Cleavage and polyadenylation specificity factor subunit 1 OS=Arabidopsis thaliana GN=CPSF160 PE=1 SV=2 99 732 5.0E-27
sp|A8XPU7|CPSF1_CAEBR Probable cleavage and polyadenylation specificity factor subunit 1 OS=Caenorhabditis briggsae GN=cpsf-1 PE=3 SV=1 127 603 2.0E-24
sp|Q9N4C2|CPSF1_CAEEL Probable cleavage and polyadenylation specificity factor subunit 1 OS=Caenorhabditis elegans GN=cpsf-1 PE=3 SV=2 127 767 5.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0003676 nucleic acid binding Yes
GO:0110165 cellular anatomical entity No
GO:0043229 intracellular organelle No
GO:0003674 molecular_function No
GO:0043226 organelle No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6305
MQVYTELVAPSAVTHCISLSLISPSATNLVVAKGSLLQIFTVKSISAELDPQTHQADEDTSKPDAQFDHRANDDD
GLESSFLGGEAMLLRTDRSTNAKLVLVAELPLAGTVIGLARVSTAKTASGGDALLIAYRAAKMSLNEWHPQRATL
ETTSIHFYEKDELMGVPWELALSDYVTYLEADPGSRCAALKFGSRNLAILPLAQSEQDLGMDDWDEDLDGPRPPK
ETATLADGADDKLAPAYTPSFVLSLPLLDPTLLHPIHLAFLHEYREPTFGILSAAQAPSFALGLKDSLSYKVFTL
DLKQRASTTILSVTGLPQDLFRVIALPAPMGGALLVGLNELIHIDQSGKPNGVAVNDVAKQVTSFSLSDQSDLNW
RLERCVIEHLAIDNGELLLVLNDGRLGIINFKIDGRTVSGISVKSVAPDCGGQLISSSVSCMSRLDSKSVFVGSE
SGDSVVLGWSRKQSQEKRQKTRFLDPDLGIDIDDLELSEEDDDDLYGNDNVAAKTSQAANGTSKLGEMLFKIQDT
LLCIAPLLDMTCGSPTPLPGAERAQLDQGISAGLQLACAVGRGKAGSIAILNRNIQPKIIGRFEFPEARGFWTMC
VKKPMPKSLGATAAVGSDYDTTAQYDRYMIVAKVDLDGYETSDVYALRAAGFESLKETEFEPAAGFTVEAGVMGK
QMRIIQVLKSEVRCYDGDLGLAQIVPMLDEETGAEPRVTSASIVDPYLLLIRDDGTVFVAQIDGNNELDEMDKTD
SPLQTSKWTAGCLYSDALCTFRPDVGDKGVEIGDKVLMFLLNSAGALHIYELPDVAKPVFVAECLTSIPPVLSAD
YAARRGASRESVSEILVADIGDTVSQAPYLIVRHCTDDLTLYEPIRYPGNGASIGLEATLAFKKCANGVLAQDAD
TTPRDESEPRRFVPLRRCANIGGLSTVFLPGPCPSFVVKSSKSIPRIVGLEGLGVRGMSTFHAEGCDRGFIYADS
EGIARVTQLPAATNLAELGISVKKIALGGDVDKISYHHATGTYIAACTVMEPFELPRDDDYHREWARESCRLPPA
MPRGMLKLINPATWTVIHTVEMEPSESIESMRTLLLEVSEETRERRMLLAVGTALSKGEDLPTRGRVQVFDIVTV
IPEPNRPETNRRLKLIAKEDIPRGGVTALSEIGRQGLMLVAQGQKCMVRGLKEDGSLLPVAFLDMNCHVASIREL
PGTGLCLLADAFKGLWFTGYTEEPYTFKVLGKSSGRLPLLVADFLPDGDDLSMVAVDADGDLHIFEFNPEHPKSL
QGHILLHRATFSVAPNIATTTLLLPRTLPRGHSNPQQQQGAAPTQQTHILLLASPSGHLAALTPVPESTYRRLLS
VANQLVPALPAHGGLHAKTFRLPDSQQAGRAALPVGVDTGGRAVVDGAVLAAWTALGAAKRAEVAGKGGYDGVGD
LREDLQALLGWNSLSYF*
Coding >OphauB2|6305
ATGCAGGTCTACACGGAGCTCGTGGCTCCCTCGGCCGTCACGCATTGTATTAGCCTGTCGCTCATATCACCGTCG
GCCACCAATCTTGTCGTCGCAAAAGGCTCGCTGCTGCAAATCTTCACCGTCAAATCCATCTCGGCCGAGCTCGAT
CCCCAGACCCACCAGGCTGATGAGGACACATCTAAACCTGATGCACAATTTGATCATCGCGCCAATGATGACGAT
GGCCTCGAGTCGTCCTTTCTTGGAGGAGAGGCCATGCTGTTGCGTACTGACCGCTCAACTAATGCCAAGCTGGTC
CTTGTGGCCGAGCTTCCTCTTGCTGGCACCGTCATTGGCCTGGCTCGTGTCAGCACTGCAAAGACAGCTTCAGGA
GGCGATGCGCTGCTCATCGCCTACCGCGCCGCCAAGATGAGCCTCAACGAGTGGCATCCGCAGAGGGCCACGCTC
GAAACGACCTCGATCCACTTCTACGAAAAAGACGAGCTCATGGGCGTGCCTTGGGAGCTGGCCCTGAGCGACTAC
GTCACCTATCTAGAGGCTGATCCAGGGAGCCGATGCGCCGCCCTTAAATTCGGGTCCCGTAACCTGGCAATTCTG
CCTCTTGCTCAGTCGGAGCAGGACCTCGGCATGGACGACTGGGATGAGGATCTCGACGGACCACGTCCGCCCAAG
GAGACCGCCACGCTCGCCGATGGAGCTGATGACAAGCTCGCACCTGCATATACGCCTTCTTTTGTGTTGAGCCTT
CCTCTACTCGACCCTACACTGCTCCATCCAATCCACCTTGCCTTTTTGCACGAGTACCGCGAGCCGACGTTTGGC
ATTCTCTCCGCGGCCCAGGCACCATCATTTGCCCTCGGCCTCAAGGACAGCCTGTCCTACAAGGTATTCACTCTG
GATCTTAAACAGCGAGCTTCGACGACTATCCTATCTGTGACGGGCTTGCCTCAGGACCTCTTTCGAGTCATTGCC
CTACCAGCGCCAATGGGCGGCGCTCTTCTTGTCGGTCTCAACGAACTCATTCATATAGATCAATCTGGAAAGCCC
AACGGAGTAGCAGTCAATGATGTTGCAAAGCAAGTCACTTCTTTTAGCCTATCTGATCAGTCGGATCTCAACTGG
AGACTGGAACGCTGTGTCATTGAGCACCTTGCCATTGATAATGGCGAACTCTTGTTGGTTCTAAATGATGGCCGC
CTCGGCATCATCAACTTCAAGATAGACGGACGCACTGTGTCAGGAATTAGTGTCAAGTCGGTGGCCCCAGACTGC
GGTGGACAATTGATCAGCAGTAGCGTCTCATGCATGTCGCGCCTTGACAGCAAATCTGTTTTCGTTGGAAGCGAA
AGCGGAGACAGTGTGGTTCTGGGCTGGTCAAGAAAACAGAGCCAGGAAAAACGACAAAAGACACGTTTTCTGGAC
CCCGACTTGGGAATCGACATTGACGACCTGGAATTAAGTGAGGAGGATGATGACGACTTGTACGGCAATGATAAT
GTAGCAGCCAAGACGTCGCAGGCTGCCAATGGCACATCAAAGCTTGGAGAAATGCTCTTCAAAATACAAGACACG
CTGCTTTGCATCGCACCGCTACTCGACATGACATGCGGAAGTCCCACTCCGCTACCTGGGGCCGAAAGAGCTCAG
TTGGATCAGGGTATATCAGCTGGGCTTCAGCTTGCCTGTGCCGTAGGACGAGGCAAAGCAGGATCCATAGCAATC
TTGAATCGGAATATCCAACCCAAGATTATTGGTCGTTTCGAGTTTCCCGAAGCACGCGGCTTCTGGACCATGTGT
GTGAAGAAGCCCATGCCAAAATCGTTGGGAGCAACGGCGGCCGTGGGCAGCGACTATGACACGACGGCCCAATAC
GATAGGTATATGATTGTGGCAAAAGTGGATCTCGACGGCTATGAAACATCTGATGTGTACGCGTTGAGAGCGGCA
GGTTTTGAGAGCCTCAAGGAGACAGAATTTGAGCCCGCGGCCGGCTTTACAGTCGAGGCCGGAGTCATGGGAAAA
CAAATGAGAATCATCCAGGTGCTCAAGTCTGAGGTTCGATGCTATGATGGCGACCTCGGACTGGCGCAGATTGTG
CCCATGTTGGACGAAGAGACGGGTGCCGAGCCTCGAGTGACAAGCGCCAGCATTGTCGACCCGTACCTGCTCTTG
ATTCGCGATGACGGCACCGTATTTGTCGCGCAGATTGATGGAAACAACGAGCTCGACGAGATGGACAAGACGGAC
AGTCCGCTGCAGACAAGCAAATGGACGGCGGGGTGTCTGTACAGCGACGCCCTGTGCACATTCAGGCCAGATGTC
GGCGACAAAGGAGTTGAGATTGGTGACAAGGTGCTAATGTTTTTGCTCAACTCTGCCGGAGCCCTGCATATATAC
GAGCTGCCTGATGTTGCAAAGCCAGTTTTTGTAGCAGAGTGTCTGACGTCCATCCCCCCTGTTCTCTCGGCAGAT
TATGCAGCCCGCCGAGGCGCCAGTCGTGAAAGCGTGTCCGAGATTCTCGTGGCAGATATTGGCGACACAGTGTCT
CAAGCGCCTTATCTGATTGTACGGCATTGTACCGACGACTTGACGCTGTACGAGCCCATTAGATACCCAGGAAAC
GGCGCTTCGATTGGGCTGGAGGCGACGTTGGCCTTCAAAAAGTGCGCCAACGGAGTTTTGGCCCAAGACGCAGAT
ACGACACCACGCGATGAGAGCGAGCCACGGCGGTTTGTGCCTCTGCGGCGATGCGCCAACATTGGCGGCCTCAGC
ACCGTATTCTTGCCTGGGCCATGTCCAAGCTTTGTGGTCAAGAGCAGCAAGAGCATACCCCGGATAGTGGGGCTT
GAAGGCCTGGGCGTGCGCGGCATGAGCACCTTTCACGCTGAGGGGTGTGATCGAGGCTTCATCTACGCCGACTCG
GAAGGCATCGCAAGGGTTACGCAGCTCCCAGCCGCGACAAACCTGGCCGAGTTGGGCATTTCTGTCAAGAAGATT
GCTCTGGGTGGCGACGTGGACAAGATATCCTATCACCATGCTACTGGAACATATATTGCTGCGTGTACAGTCATG
GAGCCGTTTGAGCTTCCGCGCGACGACGACTATCACCGCGAGTGGGCGAGAGAATCCTGCCGCCTTCCGCCGGCG
ATGCCGCGCGGCATGCTCAAGCTCATCAACCCAGCGACATGGACCGTCATCCACACAGTCGAGATGGAGCCGAGT
GAGTCTATTGAGAGCATGCGGACGCTTCTTCTCGAAGTATCAGAGGAGACGAGGGAGCGGCGGATGCTGCTTGCA
GTGGGTACCGCCTTGTCCAAGGGCGAAGACCTGCCTACAAGGGGACGGGTGCAGGTATTTGATATTGTCACAGTG
ATACCCGAGCCCAACCGGCCAGAGACAAACCGGCGGCTCAAGCTGATTGCCAAGGAAGACATTCCGCGCGGCGGC
GTGACGGCGCTGTCAGAAATTGGGCGGCAGGGCCTGATGCTGGTGGCACAGGGCCAGAAGTGCATGGTGCGCGGA
CTCAAGGAGGACGGATCTCTGCTTCCTGTTGCCTTTCTGGATATGAATTGTCACGTGGCGAGTATTCGCGAGCTG
CCTGGCACGGGGCTGTGTCTGCTGGCGGATGCCTTCAAGGGGCTCTGGTTCACGGGGTACACCGAGGAGCCATAC
ACATTCAAGGTTCTGGGCAAGAGCAGTGGGAGATTGCCGCTGCTAGTGGCGGATTTCCTGCCTGACGGTGACGAT
TTATCCATGGTGGCGGTGGACGCTGACGGCGATTTGCACATTTTCGAGTTTAATCCCGAGCATCCCAAGAGCTTA
CAGGGCCATATTCTCTTGCACCGAGCAACCTTTTCCGTGGCGCCAAACATTGCCACGACGACTCTCCTCCTACCA
CGCACCCTGCCTCGAGGCCACAGCAACCCTCAGCAGCAACAGGGCGCCGCGCCCACGCAACAGACACACATTCTC
CTCCTTGCCTCTCCGTCGGGCCACCTCGCGGCCCTGACGCCGGTGCCTGAATCGACATATCGCCGGCTGCTTTCG
GTAGCCAACCAGCTTGTGCCTGCGCTGCCTGCGCACGGCGGCCTGCACGCCAAGACGTTTCGCCTGCCCGACAGC
CAGCAGGCCGGGCGGGCGGCGCTGCCGGTTGGCGTGGACACGGGCGGTAGAGCAGTCGTGGACGGCGCCGTCTTG
GCGGCCTGGACGGCGCTGGGGGCGGCAAAGAGGGCCGAGGTGGCCGGCAAGGGCGGATATGACGGCGTGGGGGAT
TTGAGGGAGGATCTACAGGCCTTGCTGGGCTGGAATAGCTTGTCGTATTTTTAA
Transcript >OphauB2|6305
ATGCAGGTCTACACGGAGCTCGTGGCTCCCTCGGCCGTCACGCATTGTATTAGCCTGTCGCTCATATCACCGTCG
GCCACCAATCTTGTCGTCGCAAAAGGCTCGCTGCTGCAAATCTTCACCGTCAAATCCATCTCGGCCGAGCTCGAT
CCCCAGACCCACCAGGCTGATGAGGACACATCTAAACCTGATGCACAATTTGATCATCGCGCCAATGATGACGAT
GGCCTCGAGTCGTCCTTTCTTGGAGGAGAGGCCATGCTGTTGCGTACTGACCGCTCAACTAATGCCAAGCTGGTC
CTTGTGGCCGAGCTTCCTCTTGCTGGCACCGTCATTGGCCTGGCTCGTGTCAGCACTGCAAAGACAGCTTCAGGA
GGCGATGCGCTGCTCATCGCCTACCGCGCCGCCAAGATGAGCCTCAACGAGTGGCATCCGCAGAGGGCCACGCTC
GAAACGACCTCGATCCACTTCTACGAAAAAGACGAGCTCATGGGCGTGCCTTGGGAGCTGGCCCTGAGCGACTAC
GTCACCTATCTAGAGGCTGATCCAGGGAGCCGATGCGCCGCCCTTAAATTCGGGTCCCGTAACCTGGCAATTCTG
CCTCTTGCTCAGTCGGAGCAGGACCTCGGCATGGACGACTGGGATGAGGATCTCGACGGACCACGTCCGCCCAAG
GAGACCGCCACGCTCGCCGATGGAGCTGATGACAAGCTCGCACCTGCATATACGCCTTCTTTTGTGTTGAGCCTT
CCTCTACTCGACCCTACACTGCTCCATCCAATCCACCTTGCCTTTTTGCACGAGTACCGCGAGCCGACGTTTGGC
ATTCTCTCCGCGGCCCAGGCACCATCATTTGCCCTCGGCCTCAAGGACAGCCTGTCCTACAAGGTATTCACTCTG
GATCTTAAACAGCGAGCTTCGACGACTATCCTATCTGTGACGGGCTTGCCTCAGGACCTCTTTCGAGTCATTGCC
CTACCAGCGCCAATGGGCGGCGCTCTTCTTGTCGGTCTCAACGAACTCATTCATATAGATCAATCTGGAAAGCCC
AACGGAGTAGCAGTCAATGATGTTGCAAAGCAAGTCACTTCTTTTAGCCTATCTGATCAGTCGGATCTCAACTGG
AGACTGGAACGCTGTGTCATTGAGCACCTTGCCATTGATAATGGCGAACTCTTGTTGGTTCTAAATGATGGCCGC
CTCGGCATCATCAACTTCAAGATAGACGGACGCACTGTGTCAGGAATTAGTGTCAAGTCGGTGGCCCCAGACTGC
GGTGGACAATTGATCAGCAGTAGCGTCTCATGCATGTCGCGCCTTGACAGCAAATCTGTTTTCGTTGGAAGCGAA
AGCGGAGACAGTGTGGTTCTGGGCTGGTCAAGAAAACAGAGCCAGGAAAAACGACAAAAGACACGTTTTCTGGAC
CCCGACTTGGGAATCGACATTGACGACCTGGAATTAAGTGAGGAGGATGATGACGACTTGTACGGCAATGATAAT
GTAGCAGCCAAGACGTCGCAGGCTGCCAATGGCACATCAAAGCTTGGAGAAATGCTCTTCAAAATACAAGACACG
CTGCTTTGCATCGCACCGCTACTCGACATGACATGCGGAAGTCCCACTCCGCTACCTGGGGCCGAAAGAGCTCAG
TTGGATCAGGGTATATCAGCTGGGCTTCAGCTTGCCTGTGCCGTAGGACGAGGCAAAGCAGGATCCATAGCAATC
TTGAATCGGAATATCCAACCCAAGATTATTGGTCGTTTCGAGTTTCCCGAAGCACGCGGCTTCTGGACCATGTGT
GTGAAGAAGCCCATGCCAAAATCGTTGGGAGCAACGGCGGCCGTGGGCAGCGACTATGACACGACGGCCCAATAC
GATAGGTATATGATTGTGGCAAAAGTGGATCTCGACGGCTATGAAACATCTGATGTGTACGCGTTGAGAGCGGCA
GGTTTTGAGAGCCTCAAGGAGACAGAATTTGAGCCCGCGGCCGGCTTTACAGTCGAGGCCGGAGTCATGGGAAAA
CAAATGAGAATCATCCAGGTGCTCAAGTCTGAGGTTCGATGCTATGATGGCGACCTCGGACTGGCGCAGATTGTG
CCCATGTTGGACGAAGAGACGGGTGCCGAGCCTCGAGTGACAAGCGCCAGCATTGTCGACCCGTACCTGCTCTTG
ATTCGCGATGACGGCACCGTATTTGTCGCGCAGATTGATGGAAACAACGAGCTCGACGAGATGGACAAGACGGAC
AGTCCGCTGCAGACAAGCAAATGGACGGCGGGGTGTCTGTACAGCGACGCCCTGTGCACATTCAGGCCAGATGTC
GGCGACAAAGGAGTTGAGATTGGTGACAAGGTGCTAATGTTTTTGCTCAACTCTGCCGGAGCCCTGCATATATAC
GAGCTGCCTGATGTTGCAAAGCCAGTTTTTGTAGCAGAGTGTCTGACGTCCATCCCCCCTGTTCTCTCGGCAGAT
TATGCAGCCCGCCGAGGCGCCAGTCGTGAAAGCGTGTCCGAGATTCTCGTGGCAGATATTGGCGACACAGTGTCT
CAAGCGCCTTATCTGATTGTACGGCATTGTACCGACGACTTGACGCTGTACGAGCCCATTAGATACCCAGGAAAC
GGCGCTTCGATTGGGCTGGAGGCGACGTTGGCCTTCAAAAAGTGCGCCAACGGAGTTTTGGCCCAAGACGCAGAT
ACGACACCACGCGATGAGAGCGAGCCACGGCGGTTTGTGCCTCTGCGGCGATGCGCCAACATTGGCGGCCTCAGC
ACCGTATTCTTGCCTGGGCCATGTCCAAGCTTTGTGGTCAAGAGCAGCAAGAGCATACCCCGGATAGTGGGGCTT
GAAGGCCTGGGCGTGCGCGGCATGAGCACCTTTCACGCTGAGGGGTGTGATCGAGGCTTCATCTACGCCGACTCG
GAAGGCATCGCAAGGGTTACGCAGCTCCCAGCCGCGACAAACCTGGCCGAGTTGGGCATTTCTGTCAAGAAGATT
GCTCTGGGTGGCGACGTGGACAAGATATCCTATCACCATGCTACTGGAACATATATTGCTGCGTGTACAGTCATG
GAGCCGTTTGAGCTTCCGCGCGACGACGACTATCACCGCGAGTGGGCGAGAGAATCCTGCCGCCTTCCGCCGGCG
ATGCCGCGCGGCATGCTCAAGCTCATCAACCCAGCGACATGGACCGTCATCCACACAGTCGAGATGGAGCCGAGT
GAGTCTATTGAGAGCATGCGGACGCTTCTTCTCGAAGTATCAGAGGAGACGAGGGAGCGGCGGATGCTGCTTGCA
GTGGGTACCGCCTTGTCCAAGGGCGAAGACCTGCCTACAAGGGGACGGGTGCAGGTATTTGATATTGTCACAGTG
ATACCCGAGCCCAACCGGCCAGAGACAAACCGGCGGCTCAAGCTGATTGCCAAGGAAGACATTCCGCGCGGCGGC
GTGACGGCGCTGTCAGAAATTGGGCGGCAGGGCCTGATGCTGGTGGCACAGGGCCAGAAGTGCATGGTGCGCGGA
CTCAAGGAGGACGGATCTCTGCTTCCTGTTGCCTTTCTGGATATGAATTGTCACGTGGCGAGTATTCGCGAGCTG
CCTGGCACGGGGCTGTGTCTGCTGGCGGATGCCTTCAAGGGGCTCTGGTTCACGGGGTACACCGAGGAGCCATAC
ACATTCAAGGTTCTGGGCAAGAGCAGTGGGAGATTGCCGCTGCTAGTGGCGGATTTCCTGCCTGACGGTGACGAT
TTATCCATGGTGGCGGTGGACGCTGACGGCGATTTGCACATTTTCGAGTTTAATCCCGAGCATCCCAAGAGCTTA
CAGGGCCATATTCTCTTGCACCGAGCAACCTTTTCCGTGGCGCCAAACATTGCCACGACGACTCTCCTCCTACCA
CGCACCCTGCCTCGAGGCCACAGCAACCCTCAGCAGCAACAGGGCGCCGCGCCCACGCAACAGACACACATTCTC
CTCCTTGCCTCTCCGTCGGGCCACCTCGCGGCCCTGACGCCGGTGCCTGAATCGACATATCGCCGGCTGCTTTCG
GTAGCCAACCAGCTTGTGCCTGCGCTGCCTGCGCACGGCGGCCTGCACGCCAAGACGTTTCGCCTGCCCGACAGC
CAGCAGGCCGGGCGGGCGGCGCTGCCGGTTGGCGTGGACACGGGCGGTAGAGCAGTCGTGGACGGCGCCGTCTTG
GCGGCCTGGACGGCGCTGGGGGCGGCAAAGAGGGCCGAGGTGGCCGGCAAGGGCGGATATGACGGCGTGGGGGAT
TTGAGGGAGGATCTACAGGCCTTGCTGGGCTGGAATAGCTTGTCGTATTTTTAA
Gene >OphauB2|6305
ATGCAGGTCTACACGGAGCTCGTGGCTCCCTCGGCCGTCACGCATTGTATTAGCCTGTCGCTCATATCACCGTCG
GCCACCAATCTTGTCGTCGCAAAAGGCTCGCTGCTGCAAATCTTCACCGTCAAATCCATCTCGGCCGAGCTCGAT
CCCCAGACCCACCAGGCTGATGAGGACACATCTAAACCTGATGCACAATTTGATCATCGCGCCAATGATGACGAT
GGCCTCGAGTCGTCCTTTCTTGGAGGAGAGGCCATGCTGTTGCGTACTGACCGCTCAACTAATGCCAAGCTGGTC
CTTGTGGCCGAGCTTCCTCTTGCTGGCACCGTCATTGGCCTGGCTCGTGTCAGCACTGCAAAGACAGCTTCAGGA
GGCGATGCGCTGCTCATCGCCTACCGCGCCGCCAAGATGAGCCTCAACGAGTGGCATCCGCAGAGGGCCACGCTC
GAAACGACCTCGATCCACTTCTACGAAAAAGACGAGCTCATGGGCGTGCCTTGGGAGCTGGCCCTGAGCGACTAC
GTCACCTATCTAGAGGCTGATCCAGGGAGCCGATGCGCCGCCCTTAAATTCGGGTCCCGTAACCTGGCAATTCTG
CCTCTTGCTCAGTCGGAGCAGGACCTCGGCATGGACGACTGGGATGAGGATCTCGACGGACCACGTCCGCCCAAG
GAGACCGCCACGCTCGCCGATGGAGCTGATGACAAGCTCGCACCTGCATATACGCCTTCTTTTGTGTTGAGCCTT
CCTCTACTCGACCCTACACTGCTCCATCCAATCCACCTTGCCTTTTTGCACGAGTACCGCGAGCCGACGTTTGGC
ATTCTCTCCGCGGCCCAGGCACCATCATTTGCCCTCGGCCTCAAGGACAGCCTGTCCTACAAGGTATTCACTCTG
GATCTTAAACAGCGAGCTTCGACGACTATCCTATCTGTGACGGGCTTGCCTCAGGACCTCTTTCGAGTCATTGCC
CTACCAGCGCCAATGGGCGGCGCTCTTCTTGTCGGTCTCAACGAACTCATTCATATAGATCAATCTGGAAAGCCC
AACGGAGTAGCAGTCAATGATGTTGCAAAGCAAGTCACTTCTTTTAGCCTATCTGATCAGTCGGATCTCAACTGG
AGACTGGAACGCTGTGTCATTGAGCACCTTGCCATTGATAATGGCGAACTCTTGTTGGTTCTAAATGATGGCCGC
CTCGGCATCATCAACTTCAAGATAGACGGACGCACTGTGTCAGGAATTAGTGTCAAGTCGGTGGCCCCAGACTGC
GGTGGACAATTGATCAGCAGTAGCGTCTCATGCATGTCGCGCCTTGACAGCAAATCTGTTTTCGTTGGAAGCGAA
AGCGGAGACAGTGTGGTTCTGGGCTGGTCAAGAAAACAGAGCCAGGAAAAACGACAAAAGACACGTTTTCTGGAC
CCCGACTTGGGAATCGACATTGACGACCTGGAATTAAGTGAGGAGGATGATGACGACTTGTACGGCAATGATAAT
GTAGCAGCCAAGACGTCGCAGGCTGCCAATGGCACATCAAAGCTTGGAGAAATGCTCTTCAAAATACAAGACACG
CTGCTTTGCATCGCACCGCTACTCGACATGACATGCGGAAGTCCCACTCCGCTACCTGGGGCCGAAAGAGCTCAG
TTGGATCAGGGTATATCAGCTGGGCTTCAGCTTGCCTGTGCCGTAGGACGAGGCAAAGCAGGATCCATAGCAATC
TTGAATCGGAATATCCAACCCAAGATTATTGGTCGTTTCGAGTTTCCCGAAGCACGCGGCTTCTGGACCATGTGT
GTGAAGAAGCCCATGCCAAAATCGTTGGGAGCAACGGCGGCCGTGGGCAGCGACTATGACACGACGGCCCAATAC
GATAGGTATATGATTGTGGCAAAAGTGGATCTCGACGGCTATGAAACATCTGATGTGTACGCGTTGAGAGCGGCA
GGTTTTGAGAGCCTCAAGGAGACAGAATTTGAGCCCGCGGCCGGCTTTACAGTCGAGGCCGGAGTCATGGGAAAA
CAAATGAGAATCATCCAGGTGCTCAAGTCTGAGGTTCGATGCTATGATGGCGGTAAGTTTGCGTCAAGGACTATT
GACTCGTCAAGGCCATGGCTGATTATAACAAGACCTCGGACTGGCGCAGATTGTGCCCATGTTGGACGAAGAGAC
GGGTGCCGAGCCTCGAGTGACAAGCGCCAGCATTGTCGACCCGTACCTGCTCTTGATTCGCGATGACGGCACCGT
ATTTGTCGCGCAGATTGATGGAAACAACGAGCTCGACGAGATGGACAAGACGGACAGTCCGCTGCAGACAAGCAA
ATGGACGGCGGGGTGTCTGTACAGCGACGCCCTGTGCACATTCAGGCCAGATGTCGGCGACAAAGGAGTTGAGAT
TGGTGACAAGGTGCTAATGTTTTTGCTCAACTCTGCCGGAGCCCTGCATGTGAGTCTGTTGTGAGGAGCCCTGCA
ACTGCAGCAGAACAACTAACCAAGGCTAGATATACGAGCTGCCTGATGTTGCAAAGCCAGTTTTTGTAGCAGAGT
GTCTGACGTCCATCCCCCCTGTTCTCTCGGCAGATTATGCAGCCCGCCGAGGCGCCAGTCGTGAAAGCGTGTCCG
AGATTCTCGTGGCAGATATTGGCGACACAGTGTCTCAAGCGCCTTATCTGATTGTAAGAATGTTGTCCGCAACGG
CTGGCAAGTAAGCTAATGGTGTTCCAGGTACGGCATTGTACCGACGACTTGACGCTGTACGAGCCCATTAGATAC
CCAGGAAACGGCGCTTCGATTGGGCTGGAGGCGACGTTGGCCTTCAAAAAGTGCGCCAACGGAGTTTTGGCCCAA
GACGCAGATACGACACCACGCGATGAGAGCGAGCCACGGCGGTTTGTGCCTCTGCGGCGATGCGCCAACATTGGC
GGCCTCAGCACCGTATTCTTGCCTGGGCCATGTCCAAGCTTTGTGGTCAAGAGCAGCAAGAGCATACCCCGGATA
GTGGGGCTTGAAGGCCTGGGCGTGCGCGGCATGAGCACCTTTCACGCTGAGGGGTGTGATCGAGGCTTCATCTAC
GCCGACTCGGAAGGCATCGCAAGGGTTACGCAGCTCCCAGCCGCGACAAACCTGGCCGAGTTGGGCATTTCTGTC
AAGAAGATTGCTCTGGGTGGCGACGTGGACAAGATATCCTATCACCATGCTACTGGAACATATATTGCTGCGTGT
ACAGTCATGGAGCCGTTTGAGCTTCCGCGCGACGACGACTATCACCGCGAGTGGGCGAGAGAATCCTGCCGCCTT
CCGCCGGCGATGCCGCGCGGCATGCTCAAGCTCATCAACCCAGCGACATGGACCGTCATCCACACAGTCGAGATG
GAGCCGAGTGAGTCTATTGAGAGCATGCGGACGCTTCTTCTCGAAGTATCAGAGGAGACGAGGGAGCGGCGGATG
CTGCTTGCAGTGGGTACCGCCTTGTCCAAGGGCGAAGACCTGCCTACAAGGGGACGGGTGCAGGTATTTGATATT
GTCACAGTGATACCCGAGCCCAACCGGCCAGAGACAAACCGGCGGCTCAAGCTGATTGCCAAGGAAGACATTCCG
CGCGGCGGCGTGACGGCGCTGTCAGAAATTGGGCGGCAGGGCCTGATGCTGGTGGCACAGGGCCAGAAGTGCATG
GTGCGCGGACTCAAGGAGGACGGATCTCTGCTTCCTGTTGCCTTTCTGGATATGAATTGTCACGTGGCGAGTATT
CGCGAGCTGCCTGGCACGGGGCTGTGTCTGCTGGCGGATGCCTTCAAGGGGCTCTGGTTCACGGGGTACACCGAG
GAGCCATACACATTCAAGGTTCTGGGCAAGAGCAGTGGGAGATTGCCGCTGCTAGTGGCGGATTTCCTGCCTGAC
GGTGACGATTTATCCATGGTGGCGGTGGACGCTGACGGCGATTTGCACATTTTCGAGTTTAATCCCGAGCGTAAG
TCTAGGAAGCCATGACGGCGCGTCGTGGACATGGAGACACGGCTGACGAGAGAAACTAGATCCCAAGAGCTTACA
GGGCCATATTCTCTTGCACCGAGCAACCTTTTCCGTGGCGCCAAACATTGCCACGACGACTCTCCTCCTACCACG
CACCCTGCCTCGAGGCCACAGCAACCCTCAGCAGCAACAGGGCGCCGCGCCCACGCAACAGACACACATTCTCCT
CCTTGCCTCTCCGTCGGGCCACCTCGCGGCCCTGACGCCGGTGCCTGAATCGACATATCGCCGGCTGCTTTCGGT
AGCCAACCAGCTTGTGCCTGCGCTGCCTGCGCACGGCGGCCTGCACGCCAAGACGTTTCGCCTGCCCGACAGCCA
GCAGGCCGGGCGGGCGGCGCTGCCGGTTGGCGTGGACACGGGCGGTAGAGCAGTCGTGGACGGCGCCGTCTTGGC
GGCCTGGACGGCGCTGGGGGCGGCAAAGAGGGCCGAGGTGGCCGGCAAGGGCGGATATGACGGCGTGGGGGATTT
GAGGGAGGATCTACAGGCCTTGCTGGGCTGGAATAGCTTGTCGTATTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail